delusion grou high visio jav javcensored censored




FC2HMNSTARSNGODCJODVENUMEYDNNPJBBANVEMAVENXMARASQTENATRSPRDCHRVMIAAGMEMWAAAABWAUKG

2023-03-04
105 min

COGM-040 ＜Forbidden Taste＞A Thrilled Flirt With Friends Who Peeked In Ruins Where No One Else Was There.

  • censoredamateurCOGMkoguma mousouzokuCOGM-040COGM040cogm00040
    • 2023-03-04
    140 min

    PKPD-232 My First Ntr Asami (30 Years Old) My First Sexless Wife From Her Husband Asami Mizuhata

  • mizubata asami censoredcreampiesingle workPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-232PKPD232pkpd00232
    • 2023-03-04
    128 min

    SORA-444 Is It Yukari, A Sacred Masochist Girl Who Specializes In Shame And Is Humiliated And Ecstatic

  • is it yukari s censoredsingle workSORAyama to sorahimurokkuSORA-444SORA444sora00444
    • 2023-03-04
    120 min

    EVIS-458 Outdoor Exposure Lesbian

  • megumi shino nagaoka censoredslutEVISebisusan mousou zokuEVIS-458EVIS458evis00458
    • 2023-03-04
    128 min

    KHIP-008 My Niece, Who Came To My House Due To Poor Behavior, Couldn'T Put Up With Momojiri Peeking Out Of Her J-Miniskirt, And When She Attacked Me, She Unexpectedly Honestly Made Me Do It And Creampied Every Day Since Then! Yokomiya Nanami

  • yokomiya nanami censoredcreampieschoolgirlKHIPkaguya hime pt mousozokuno tonkaguya hipKHIP-008KHIP008khip00008
    • 2023-03-04
    138 min

    SORA-445 The Desire For Approval From The Former Race Queen Of The H Cup Is So Strong That She Listens To Anything You Say, She Is Drooling In An Outdoor Cowgirl Position, Irresponsible, And Her Face Falls Down Saetan (*^^*)

  • censoredamateurSORAyama to soratokyo rouman chikaSORA-445SORA445sora00445
    • 2023-03-04
    126 min

    BABD-001 I Have Sex Live On Dangerous Days Once A Month 001 Erika Ozaki Erika

  • ozaki erika censoredcreampiesingle workBABDdeep mousozokuBABD-001BABD001babd00001
    • 2023-03-04
    140 min

    PKPL-027 Completely Private Footage: First Sleepover Alone With An H-Cup Beauty With Colossal Breasts, Tsukishima Sakura, Who Is Intelligent And Motherly

  • tsukishima sakura censoredcreampiesingle workPKPLpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPL-027PKPL027pkpl00027
    • 2023-03-04
    244 min

    KTKY-070 “Let'S Throw Away Our Virginity And Embark On A Trip” 4 Hours

  • censoredamateurKTKYkichikkusu mousou zokuKTKY-070KTKY070ktky00070
    • 2023-03-04
    137 min

    PKPD-233 Choroman G-Cup Black Gal Who Makes Me Creampied At Lunch J● Lumina Sena Lumina

  • sena rumina censoredcreampiesingle workPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-233PKPD233pkpd00233
    • 2023-03-04
    120 min

    EVIS-457 Saliva-Covered Face-Licking Lesbian

  • suzuya strawberry full moon hikari censoredslutEVISebisusan mousou zokubyakkoEVIS-457EVIS457evis00457
    • 2023-03-04
    129 min

    KTKZ-103 Having Long Nipples Is A Complex Girl Kaori ~ I'M Crazy About You With Super Sensitive Squishy Nipples Who Have Full Erections All Year Round ~

  • censoredamateurKTKZkichikkusu mousou zokushinjinKTKZ-103KTKZ103ktkz00103
    • 2023-02-25
    302 min

    HOIZ-073 Hoihoi Panchi 28 Amateur Hoihoi Z, Personal Shoot, Beautiful Girl, Matching App, Pov, Amateur, Sns, Back Side, Beautiful Breasts, Slender, Facial, Alcohol, Dirty Talk, Big Breasts, Squirting

  • censoredamateurbeautiful girlHOIZshirouto hoihoi mousozokuHOIZ-073HOIZ073hoiz00073
    • 2023-02-25
    297 min

    ROOM-050 Rental Female Student Secret Part-Time Job That No One Can Tell Me File2

  • sumire kuramoto hironaka minami censoredcreampieschoolgirlROOMhomeroom homeroom mousozokuROOM-050ROOM050room00050
    • 2023-02-25
    91 min

    ANX-151 Shin Sui ● Reijo #Gogo #Whitebrow #Night Face #Surrender Matsukawa Chinami

  • matsukawa chinami censoredsquirtingsingle workANXsaimin kenkyuusho bekkansainansaimin rei onna saimin kenkyuusho bekkanANX-151ANX151anx00151
    • 2023-02-25
    114 min

    TIKB-153 [Be Careful Not To Be Too Clitty] Individual Shot, Perky Girl, Gal, Pov, Rikanata, Morisawa Kana

  • kana morisawa kanako iioka censoredsingle workTIKBchikichikiba gu mousozokuTIKB-153TIKB153tikb00153
    • 2023-02-25
    112 min

    AGAV-084 Rookie Gravure Idol Honoka Airi Brainwashed And Trained By A Nipple Development Cult

  • hobana airi censoredsingle workAGAVsex agentaoi buttonAGAV-084AGAV084agav00084
    • 2023-02-25
    117 min

    YNGC-001 The Crazy Beauty Salon Izumi Aya Started By Herself By The Gal Who Got Fired From Her Mens Due To Extreme Service

  • aya izumi censoredsingle workYNGCyoung corn mousozokuYNGC-001YNGC001yngc00001
    • 2023-02-25
    124 min

    AGMX-143 Masochist Man Restrained! Strong ● Ejaculation Game

  • tsukasa nagano mei uesaka censoredslutAGMXsex agentAGMX-143AGMX143agmx00143
    • 2023-02-25
    283 min

    STHS-013 Amateur Tokyo No. 13 Enko School Girl Gets Bareback And Creampied! Himari/Chihaya/Ran/Risa

  • censoredcreampieschoolgirlSTHSshirouto toukyou h s mousouzokushirouto toukyou h sSTHS-013STHS013sths00013
    • 2023-02-25
    297 min

    KSAT-067 10 Shots Of Dirty Sex With A Wife With Bottle Nipples!! Picking Up Busty Married Women

  • censoredcreampieamateurKSATkensha no shokutaku mousozokukensha no shokutakuKSAT-067KSAT067ksat00067
    • 2023-02-25
    158 min

    KATU-111 Slutty Anaconda Slutty Woman With Big Areolas, Kinky Caregiver With Big Areolas

  • censoredslutKATUkatsuo butsusan mousouzokumaglowKATU-111KATU111katu00111
    • 2023-02-25
    118 min

    TIKB-152 Tipsy, Pacolog! Bastard! A Must-See For Big Butt Lovers! Daredevil, Insane, And Extremely Hot! Drunk Women Are Extremely Erotic!

  • censoredTIKBchikichikiba gu mousozokuTIKB-152TIKB152tikb00152
    • 2023-02-24
    124 min

    FOCS-115 The 180Cm Tall Yang Ka Gal'S Yin Kya Is Hunting For Male Virgins! Super Tech Slutty Girl Play With A Man Squirting & Getting Creampied From Endless Ejaculation To A Great Ascension Day! Shibuya Hana

  • shibuya hana censoredcreampieslutFOCSabc mousou zokufocusFOCS-115FOCS115focs00115
    • 2023-02-24
    128 min

    FOCS-113 My Neighbor'S Pure Beautiful Girl Who Will Totally Affirm Me No Matter What I Do, Begging For Vaginal Cum Shot, Seeding Diary: Moeka Tsuburai

  • marui moeka censoredcreampiebeautiful girlFOCSabc mousou zokufocusFOCS-113FOCS113focs00113
    • 2023-02-24
    122 min

    FOCS-114 An Instant Maid Who Is Dying To See The Moment The Sperm Pops Out! Obsessed With Dicks Anytime, Anywhere, Yokomiya Nanami

  • yokomiya nanami censoredcreampiebeautiful girlFOCSabc mousou zokufocusFOCS-114FOCS114focs00114
    • 2023-02-24
    126 min

    BOBB-365 A Legend Who Came From The Doujinshi World! Boin “Tenshi-Chan” Where You Can Fully Enjoy The Huge Breasts Of A Boob Angel With The Finest Breast Fetishist Play Boin “Tenshi-Chan” Box

  • tenshi chan censoredcreampiesingle workBOBBabc mousou zokuboinbb abc mousou zokuBOBB-365BOBB365bobb00365
    • 2023-02-18
    118 min

    SUJI-176 Naive Big Breasts Boy ● Creampied ~ Obscene Acts By People With Abnormal Sexual Disorders ~ Saki 148 Cm Sober Girl Sakura Saki

  • sakura saki censoredcreampiebeautiful girlSUJIkan ran monoSUJI-176SUJI176suji00176
    • 2023-02-18
    154 min

    TANF-003 Summer Vacation Sunburn Residue And Yukino-Chan'S Swimming Pool Class

  • censoredbeautiful girlTANFtanpopo mousozokufurawaTANF-003TANF003tanf00003
    • 2023-02-18
    130 min

    EVIS-455 Twisted Erect Nipples

  • chie aoi natsume atago censoredEVISebisusan mousou zokuEVIS-455EVIS455evis00455
    • 2023-02-18
    199 min

    FUNK-008 In A Small Public Restroom, A Beautiful Woman With Hidden Big Breasts Who Picked Up Girls On A Matching App Said, “Please Take A Look At My Masturbation!” Immediate Money Negotiations!! I Don'T Hide My Excitement From My Full Erect Cock Righ

  • censoredcreampieamateurFUNKfuncity mousozokufuncityFUNK-008FUNK008funk00008
    • 2023-02-18
    173 min

    FUNK-009 A Beautiful Mens Girl With A Mask That Is Too Extreme Makes Customers Burn, Get An Erection, And Then Rub It Through A Pimp To Induce Bareback Sex

  • censoredcreampieslutFUNKfuncity mousozokufuncityFUNK-009FUNK009funk00009
    • 2023-02-18
    120 min

    SUJI-177 Brother-Sister Incest Forbidden Domestic Play Obscene Creampied Sexual Intercourse

  • censoredcreampieschoolgirlSUJIkan ran monoSUJI-177SUJI177suji00177
    • 2023-02-18
    115 min

    ONIN-083 The Glans That Pop Out While Being Cheated On By A Girl With A Penetrating Masturbator Get Fellatio

  • censoredONINtamanegi mousouzokudoryuu barimoatamanegiONIN-083ONIN083onin00083
    • 2023-02-18
    120 min

    SUJI-178 Strong Married Woman ● Hot Spring Ryokan Massage Rape Video

  • censoredcreampieSUJIkan ran monoSUJI-178SUJI178suji00178
    • 2023-02-18
    114 min

    EVIS-453 Belo Lesbian Kiss

  • aikawa mirei tsukino drop censoredEVISebisusan mousou zokubyakkoEVIS-453EVIS453evis00453
    • 2023-02-18
    158 min

    ZOCM-055 Slutty Girl Begging For A Masturbator To Have Kinky Sexual Intercourse Till Morning Comes

  • natsuki kisaragi nanjo miyako censoredcreampieslutZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-055ZOCM055zocm00055
    • 2023-02-18
    110 min

    EVIS-454 Foot Odor Sniffing Hand Job

  • natsuki kisaragi honda satomi censoredschoolgirlEVISebisusan mousou zokucherry amp miyamaEVIS-454EVIS454evis00454
    • 2023-02-11
    124 min

    SNTX-016 Brought In Girls, Hidden Sex Footage, And Released Av Without Permission. The Office Worker Who Does It Vol.16

  • censoredamateurbeautiful girlSNTXsou mi sha mousou zokusoumisha mousou zokuSNTX-016SNTX016sntx00016
    • 2023-02-11
    123 min

    MASM-010 My House Was Taken Over By A Damn Cheeky Runaway Kid! Tenma Yui Was Cursed, Her Adult Pride Was Shattered, And She Was Subjected To Reverse Scrutiny

  • yui tenma censoredcreampieschoolgirlMASMkaguya hime pt mousozokuno tonmazomanMASM-010MASM010masm00010
    • 2023-02-11
    151 min

    CHRV-173 My Little Sister'S Tits Will Ruin My Brother! My Little Sister'S Huge Breasts Are Worth Seeing! Sailor Uniform Gets Creampied! I Cup 98 Cm Saku-Chan

  • censoredcreampiesisterCHRVcherries reboCHRV-173CHRV173chrv00173
    • 2023-02-11
    141 min

    DAVK-078 Short Tall, Innocent Beautiful Girl With Shaved Pussies And Genitals Prank After School [Uncle Older Than Her Real Parents, Extremely Thick Dicks] Strips Her Single Strongly Pussies Open [Extremely Small Pistons] Continuous Pistons Immersed

  • censoreduniformschoolgirlDAVKdoujin av kurabu mousozokuhashida takamitsuDAVK-078DAVK078davk00078
    • 2023-02-11
    121 min

    MUCH-163 Momo-Chan'S Colossal Breasts Nuru Teka Full Course Fuck Minami Momo

  • minami peach censoredslutsingle workMUCHmuchimutchi mousozokumuchimutchiMUCH-163MUCH163much00163
    • 2023-02-10
    125 min

    FOCS-111 Short 145 Cm Minimum Erotic Body Girl With Full Horny Pheromone, Intense Orgasm And Intense Sex With Chase And Intense Sex In A Chase Hinata Aino

  • aino hinata censoredcreampiebeautiful girlFOCSabc mousou zokufocusFOCS-111FOCS111focs00111
    • 2023-02-10
    93 min

    BONY-036 Your Wife Is Covered In Poop, Sakura Miwa

  • sakura mito censoredcreampiesingle workBONYbonita delusional tribehanbaagu sunayamabonita mousouzokuBONY-036BONY036bony00036
    • 2023-02-10
    126 min

    BOBB-364 I Cup Of Fluffy Marshmallows With Huge Breasts! It Has A Chewy Texture (Tactile Feel) And Thoroughly Plays With Fair-Skinned Boobs And Nipples! Boin “Yumina Miyafuji” Box

  • miyafuji yumina censoredsingle workBOBBabc mousou zokuboinbb abc mousou zokuBOBB-364BOBB364bobb00364
    • 2023-02-10
    166 min

    BONY-038 Special Contract Technique For A Beautiful Life Insurance Lady Who Seduces With G-Cup Busty Erotic Body!! Kiyo Ami

  • kiyo ami censoredcreampiesingle workBONYbonita delusional tribetetbonita mousouzokuBONY-038BONY038bony00038
    • 2023-02-10
    127 min

    FOCS-112 Office Lady Byakuya Mikuru Was Fucked Everywhere In The Company By Hate Boss... Her Cock Strikes Too Much And Creampied Even Though She Hates It

  • byakuya mikuru censoredcreampiebeautiful girlFOCSabc mousou zokufocusFOCS-112FOCS112focs00112



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download