def digital mosaic squirting big tits jav




FC2VEMAHODVATIDGVHSPRDDASDADNSANSDABSQTEMARAPPPDCAWDMIDEHMNMILKAVSADASDMEYDKSBJ

2020-11-03
140 min

[SDJS-095]Saying Her Plumbing's Broke... My Colleague From Work Came To Stay At My Place For 3 Nights And 4 Days. Although She Acts Cold At Work She Gets Really Clingy When It's Just The Two Of Us... The Secret Tsundere Life - SOD Female Empl

  • miyazaki rin censoredamateurbeautiful girlSDJSsod createsuisei akaisod female employeeSDJS-095SDJS0951sdjs00095
    • 2020-11-07
    61 min

    HEYZO 2392 Beautiful Girl’s After School Life No.34 -Dick Lover!- – Nozomi Nakase

  • nozomi nakase uncensoredcreampiebukkakeheyzo
    • 2020-11-15
    106 min

    300MIUM-648 [Women who are too comfortable to hold] Rent a certain dream country cast as her who loves a smiling face too much! Completely REC the whole story that was spoiled up to the originally prohibited erotic acts by persuading! !! After enjoyi

  • amateur censoredbig titsamateurmiummium-648mium648300mium-648
    • 2020-11-18
    240 min

    [RVH-006]A Sexy P*A Director & A Mind-Blowing Female Teacher And A Bad Boy S*****t Council President Best Hits Collection vol. 1

  • hitomi enjo gloss hall shiori endo bookmark censoredRVHglory questRVH-006RVH00613rvh00006
    • 2020-12-01
    140 min

    [KIRE-012]A Thirty-Something Woman Can Raise Her Value Through Sex. Sumire Kurusu 30 Years Old Her Adult Video Debut

  • sumire kurusu censoredblowjobsingle workKIREsod createdainanabeauty kirei sodKIRE-012KIRE0121kire00012
    • 2020-12-06
    122 min

    [SORA-283]Saku Ishihara Is A Sex Doll At 20

  • censoredamateurSORAyama to soramichinari shibarakuSORA-283SORA283sora00283
    • 2020-12-10
    120 min

    [HBAD-565]The Clan That Fucks Together Stays Together This Big Stepbrother Was Secretly Fucking His Little Stepsister She Hates Her Stepdad, But When He Found Out, He Gave Her A Cock-Thrusting She Would Never Forget Rika Aimi

  • rumi tadami censoredbig titsblowjobHBADhibinonamitaro umababeHBAD-565HBAD5651hbad00565
    • 2020-12-18
    117 min

    [OMHD-002](Please Distribute) #Group Pranks Online #The Worst 5 Hackers In History Prey On A Slut With Giant Balloon Titties Azusa Misaki

  • misaki azusa censoredsingle workOMHDdogmamigiwa otaOMHD-002OMHD002omhd00002
    • 2020-12-27
    103 min

    [HONB-199]Saisho de Saigo

  • censoredamateurHONBmercurythe first shibuya special f e headquarHONB-199HONB199h-1133honb00199
    • 2020-12-27
    119 min

    [MDVHJ-026]Mother-in-law Paying A Lesbian Night Visit To The Bride: Chapter 4

  • kiriyama yuu yuri kitagawa censoredbig titslesbianMDVHJgraffiti japanmovieMDVHJ-026MDVHJ02648mdvhj00026
    • 2021-01-01
    121 min

    [CLOT-014]Pantyhose Temptation - Mitsuba Higuchi

  • mitsuha higuchi censoredcreampieblowjobCLOTplanet plusdirector ocloseCLOT-014CLOT014h-237clot00014
    • 2021-01-06
    53 min

    [sika-002]あみ＆りか

  • amateur censoredcreampieuniformsikasika-002sika002sika-002
    • 2021-01-17
    120 min

    [BST-018]Single Girl's Trip Hunting Cherry Boys - Haruka Aisawa

  • censoredamateurBSTrubysuke kato 6boston bagBST-018BST018118bst00018
    • 2021-01-23
    120 min

    [OAE-206]ALL NUDE Nana Yagi

  • nana yagi censoredsingle workOAEaircontrolOAE-206OAE206oae00206
    • 2021-01-23
    241 min

    [ITSR-088]"Taking Them Home" A Divine Collection Peeping On A Big Tits Married Woman 12 Ladies/4 Hours vol. 5

  • censoredbig titsITSRbig morkalmaxitadakiITSR-088ITSR08857itsr00088
    • 2021-02-05
    242 min

    [SCR-264]Barely Legal Teens G*******ged By Grown Ups On Camera 4 Hours

  • censoredcreampiebeautiful girlSCRglay zs crimeSCR-264SCR26412scr00264
    • 2021-02-09
    140 min

    [SDAB-167]I Thought My Stepfather Was A Creepy Bastard, And He Had An Awful Personality, But Now, We Were All Taking A Family Vacation Together ... While Mother Was Nearby, This Man I Hated With A Passion Was Fucking My Brains Out, And Yet, I Found M

  • asai censoredschoolgirlbeautiful girlSDABsod creategoemonone s youthSDAB-167SDAB1671sdab00167
    • 2021-02-19
    87 min

    [SS-016]Clarity Hikari Azusa

  • censoredcreampieschoolgirlSSglory questSS-016SS016h-113ss00016
    • 2021-02-19
    42 min

    480FRIN-020 《Personal shooting》 H cup Former famous opera troupe belonging to a beautiful stage actress SEX video leaked Variety show appearance

  • amateur censoredamateurfrinfrin-020frin020480frin-020
    • 2021-03-05
    243 min

    [DNW-112]Seducing 2 Girls 2 An Amateur Girl Seduction Hunt 30

  • censoredcreampiebig titsDNWprestigedocumentDNW-112DNW112118dnw00112
    • 2021-03-06
    239 min

    [HUNTA-960]"Please Stop! I'm Cumming So Much I Think I'm Going To Lose My Mind!" My Little Stepsister Was Thrusting Out Her Tight, Godly Ass, And I Could No Longer Resist ... So I Entered Her Raw, From Behind! And Then I Pumped Her Wi

  • censoredcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-960HUNTA960hunta00960
    • 2021-03-22
    120 min

    [GENM-077]Secret Infidelity: At A Hot Springs Resort - Rui Miura

  • rui miura censoredbig titssingle workGENMgenekigr 3GENM-077GENM077genm00077
    • 2021-03-26
    239 min

    [OKAX-721]This Dirty Old Man Says, I'll Teach You The Secrets Of Sexual Pleasure I Thought I Absolutely Hated Him, But He Made Me Feel So Good When He Toyed With My Sensual Cunt Crack 12 Girls 4 Hours 3

  • censoredcreampieblowjobOKAXk m produceokazuOKAX-721OKAX72184okax00721
    • 2021-03-28
    53 min

    FC2PPV 1744868 [Actual record] Life insurance lady’s body-hugging business was true ❤️❤️ Continued after signing a contract ❤️❤️

  • amateur uncensoredfc2
    • 2021-04-02
    133 min

    [JUL-526]Married Office Lady Shows Off Her Stocking Thighs Fucking The Shameful Boss's Wife Kana Mito

  • kana mito censoredmature womansingle workJULmadonnajotaro tomiJUL-526JUL526jul00526
    • 2021-04-02
    117 min

    [ARM-965]A Super Massive Oil Massage x "That's A Good Boy, That's A Good Boy ..." Cock Tip Stimulating Pleasure Chapter 2 2

  • hebei haruna ichinose love censoredhandjobARMaroma planningshigeo kadowakiaromaARM-965ARM965arm00965
    • 2021-04-07
    89 min

    [MSC-004](A Private Video Session) A Continuous Threesome Raw Creampie Fuck Fest! A Tiny 18-Year Old Barely Legal Babe With Black Hair *Double Blowjob Action* "Yes, Please Cum Inside Me!" She Looks Neat And Clean And Quiet, But She's A Su

  • censoredcreampieamateurMSCfuturefuture futureMSC-004MSC004
    • 2021-04-09
    131 min

    [IPX-637]Ravished By The Grossest Boss - Pounded By His Huge Cock Until She Cums - Marked By His Seed Rio Kuriyama

  • rio kuriyama censoredsingle workdramaIPXidea pocketamazing meatdishIPX-637IPX637ipx00637
    • 2021-04-15
    240 min

    [KNMD-103]My Sexy Body Can't Help But Feel Good When Fucked By My Step Dad 4 Hours

  • censoredmarried womanmature womanKNMDkinemamanjiroKNMD-103KNMD103knmd00103
    • 2021-04-24
    143 min

    [LULU-065]The Married Woman Next Door Can't Conceal How Horny She Is For Your Big Dick - She Wants To Get Pounded Daily Right Down To Her Womb With Creampie Sex. Yu Shinoda

  • shinoda yu censoredcreampiesingle workLULUlunaticsvagmanLULU-065LULU065lulu00065
    • 2021-05-01
    120 min

    [SSIS-054]I'm Delighted When My Tits Turn My Master On. Naughty Maid In Lingerie Loves To Service Her Employer. Shion Yumi

  • evening beauty censoredbig titscosplaySSISs1 no 1 stylegoemonSSIS-054SSIS054ssis00054
    • 2021-05-08
    151 min

    [APKH-173]When I Messaged The Secret Account Of A Beautiful Rich Married Woman (27 Years Old) She Immediately Agreed To Fuck Me! Filming Hot And Steamy Sex With A Slutty Adulterous Wife Wearing A Thong Mia Hanesaki

  • mia hasaki censoredcreampieblowjobAPKHaurora project annexhaurora project anexAPKH-173APKH173apkh00173
    • 2021-05-14
    118 min

    [BLK-498]I Opened The Door And Suddenly This Gal Was Sucking Me Off!! The Backdoor Cock Eating Service Of An Innocent Bitch!! Wan Horikita

  • horikita wan censoredblowjobslutBLKkira kirakira kira black galBLK-498BLK498blk00498
    • 2021-05-21
    56 min

    509JPAK-011 Arisa 2

  • amateur censoredbig titsuniformjpakjpak-011jpak011509jpak-011
    • 2021-05-23
    124 min

    [JKW-021]乳妻狩り 鎌田雪乃

  • yukino kamada censoredcreampiebig titsJKWjeweljueruJKW-021JKW021h-848jkw00021
    • 2021-05-28
    177 min

    [IBW-828]Pervert Targets Young S********l Playing By Herself And Ravishes Her

  • matsumoto ichika kamino hina censoredbeautiful girlIBWi b worksIBW-828IBW828
    • 2021-06-12
    151 min

    [MDBK-181]BHLC-Busty High Leg Cut- Oiled Up Fucks With Big Tits In High-Legged Leotards

  • oda mako inaba censoredbig titsMDBKbazookamaso knifeMDBK-181MDBK181mdbk00181
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-26
    134 min

    [MMUS-054]Provotative Panty Shot: Total Temptation Harem Office

  • hinako mori himari kinoshita himari hanazawa censoredslutMMUSmarrionkijin kasaikcpMMUS-054MMUS054mmus00054
    • 2021-07-01
    61 min

    324SRTD-0235 Dirty Mom Who Wants Saffle Sperm Even Though She Has Just Born

  • amateur censoredcreampiebig titssrtdsrtd-0235srtd0235324srtd-0235
    • 2021-07-14
    55 min

    494SIKA-095 3P Saddle A Desire Throat Lewd Gal With A Big Cock

  • amateur censoredamateurbukkakesikasika-095sika095494sika-095
    • 2021-07-19
    37 min

    FC2PPV 1927642 [Individual Shooting 46] Complete Appearance 21 Years Old Jd Streak Pie Bread D Cup Cleaning Blowjob From Continuous Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-09-04
    69 min

    SIRO-4613 [First Shot] [Whitening Naked Body] [Distorted Neat Face] Whitening Slender Receptionist Who Seems To Be Graceful. If You Bend Your Hips And Advance To The Back With Your Favorite Back, You Will Announce The Climax In A Loud Voice .. AV App

  • amateur censoredamateursirosiro-4613siro4613siro-4613
    • 2021-09-10
    149 min

    [IPX-724]"I Didn"t Want To Fuck, But I Got Fucked Anyway ..." They Came For Her, One After Another ... A Noble Race Queen Falls Prey To A Chain Reaction Baton Passing Relay Of Sex Karen Kaede

  • karen kaede censoredcosplaybeautiful girlIPXidea pocketzaku araidishIPX-724IPX724ipx00724
    • 2021-09-27
    89 min

    300MIUM-755 [This Married Woman Is The Most Dangerous! ] A Hardcore "De Metamorphosis!" That Has Been Staring At The Crotch Of Boys Since Elementary School. !! !! 』 De M Wife Who Loves Painful Irama Anyway! !! [Excessive Blowjob Desire] Immed

  • amateur censoredcreampiebig titsmiummium-755mium755300mium-755
    • 2021-10-01
    85 min

    406FTHT-024 [Cute With Anime Voice Is A Great Weapon! The Piston Shines! A Whip Butt That Pops! Service Princess] Aggressive Excess Lip Service! A Rich Blowjob With An Upper Eye That Tickles The Man’S Heart! Irama In The Back Of The Throat Is Al

  • amateur censoredcreampieamateurfthtftht-024ftht024406ftht-024
    • 2021-10-28
    58 min

    H0930 ki211028 Saki Kirigaya 34years old

  • amateur uncensoredh0930
    • 2021-11-04
    101 min

    [AKDL-148]"Study If You Want To Have Sex With Me! Fucked By Private Tutor With Backdoor Option. Reina Usami

  • reina usami censoredcreampiebeautiful girlAKDLaquinoriaquinoriaknrAKDL-148AKDL1481akdl00148



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download