creampie slut high vision censored jav




FC2KBIHDKAWAAAFSDSSDASDHMNSQTEATIDVEMAMILKDASDMIDVBLKCJODDTTSTARSSSISAVSAMIDEABW

2020-09-25
239 min

[NASH-372]Family Fun Lesbian Series Chapter 5

  • ayaka muto beautiful kyono censoredbig titslesbianNASHnadeshikoNASH-372NASH372h-067nash00372
    • 2020-10-06
    57 min

    188HINT-0419 Megumi

  • amateur censoredcreampiemarried womanhinthint-0419hint0419188hint-0419
    • 2020-10-08
    160 min

    [MIST-315]Private Titty Bar - Her Business Is Losing Money Due To The Pandemic And She Needs Cash... She's Willing To Take A Creampie On The Sly Too Shiori Tsukada

  • shiori tsukada censoredcreampiesingle workMISTmr michirusaitaMIST-315MIST3151mist00315
    • 2020-10-08
    127 min

    [TOEN-033]My Beautiful Boss Is A Super Pervert My Sadistic Lady Boss Gets Horny Whenever She's Irritated, And This Slut Will Take Her Incompetent Employees Home To Hit Them With Stress-Relieving Sex Mari Kuroki

  • kuroki mari censoredcreampiemature womanTOENcenter villageyoichi sanotaoyuanTOEN-033TOEN033h-086toen00033
    • 2020-10-18
    121 min

    [KSBJ-102]Adultery - She'll Steal Your Man's Eye Natsuki Kisaragi

  • natsuki kisaragi censoredcreampieblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-102KSBJ102ksbj00102
    • 2020-11-29
    137 min

    [MMKZ-088]This Elder Sister Type Had A Big Ass That Was So Filthy It Blew My Mind In Seconds!! Nanami Matsumoto

  • nana matsumoto censoredbig titssingle workMMKZmarrionkojiro miyamotoirisMMKZ-088MMKZ088mmkz00088
    • 2020-11-29
    66 min

    407KAG-112 Pari Pigal is thrown in a big dick and female climax! !! Unintentional discharge to the foolery of saffle who awakens her true nature ww

  • amateur censoredcreampieamateurkagkag-112kag112407kag-112
    • 2020-12-06
    104 min

    [VENU-985]I Was Nailing My Stepmom Within Two Seconds Of Her Husband Leaving The House Asuka Kiyomiya

  • kiyomiya asuka censoredcreampiebig titsVENUvenusmajime kitanofakecest winntersVENU-985VENU985venu00985
    • 2020-12-07
    40 min

    [ore-728]マイナ

  • amateur censoredcreampieamateuroreore-728ore728ore-728
    • 2020-12-11
    25 min

    FC2PPV 1602635 [No] Master. I’ll be off for a day today and I’ll enjoy “off paco” ♥ -Toys- [Personal shooting]

  • amateur uncensoredfc2
    • 2020-12-21
    15 min

    KSTC-015 Rin-san

  • amateur censoredamateurbeautiful girlkstckstc-015kstc015kstc-015
    • 2020-12-31
    60 min

    Pacopacomama 123120_408 Minami Tanaka

  • minami tanaka uncensoredcreampieblowjobpacopacomama
    • 2021-01-16
    49 min

    FC2PPV 1646670 [Uncensored / No Mo] Buyer review benefits available (High-quality version) _ [It’s not bad to take it off] Misa (Rise, Meru) / 20 years old / College student [Complete appearance] Clothed raw SEX

  • amateur uncensoredfc2
    • 2021-02-05
    53 min

    FC2PPV 1673806 [Big breasts sister] Orgy out in a house! Hcup Boyne milk hanging and straddling a man Porcio convulsions big cum ♥ Raw Saddle personal shooting party until morning [Personal shooting]

  • amateur uncensoredfc2
    • 2021-02-24
    52 min

    FC2PPV 1700264 I’m going with a nipple! ] Health-loving married woman, 26 years old, milk to fill at the end of breastfeeding! Free massage pick-up on SNS for married women suffering from stiff shoulders. Pretending to be a treatment, Acme fell

  • amateur uncensoredfc2
    • 2021-03-01
    119 min

    [SMSD-022]Female Prisoner Illusion - Aya Shiomi

  • aya shiomi censoredbdsmsingle workSMSDs m sniperSMSD-022SMSD022h-1126smsd00022
    • 2021-03-11
    119 min

    [ZEAA-059]Cum Loving Wife Masochistic Married Woman Loves Taking Lots Of Loads Yuri Tadokoro

  • yuri tadokoro censoredcreampiemarried womanZEAAcenter villagesky cloudsthe pole center villageZEAA-059ZEAA059h-086zeaa00059
    • 2021-03-13
    178 min

    [DASD-825]Flesh Fantasy Nookie These Girls Absolutely Won't Show Their Faces File.001 Yuka (Not Her Real Name)

  • censoredamateurDASDdashajime yanaiDASD-825DASD825dasd00825
    • 2021-03-17
    41 min

    FC2PPV 1729752 * None * I’m sorry for my husband ( ∀) Married woman KUREHA 8 months pregnant just before giving birth! Demon Iki in the last rich affair raw Saddle SEX ♡

  • amateur uncensoredfc2
    • 2021-03-20
    121 min

    390JAC-085 [G Big Breasts Golfer x Creampie Facials 4 Barrage] G Big Breasts Kitsukitsuma ● Hole in One! Unequaled libido super sensitive constitution Ikuiku chip in birdie! Bishabasha Squirting "This tide far!" This woman is exactly the priz

  • amateur censoredcreampiebig titsjacjac-085jac085390jac-085
    • 2021-03-27
    239 min

    [HUSR-232](Don't Know Which Porn To Pick？ Pick This One!) You'll Blow Your Load In 3 Minutes. 45" L-Cup Colossal Tits! Gorgeous Eastern European MILF Takes An Anal Creampie During Wild Orgasmic Sex! Cathy Heaven BEST Collection 4 Hours 2

  • kathy haven censoredanalbig titsHUSRbig morkalbooker thussleHUSR-232HUSR23257husr00232
    • 2021-04-01
    60 min

    324SRTD-0220 A case where a longing colleague was drunk and brought to a hotel

  • amateur censoredamateursrtdsrtd-0220srtd0220324srtd-0220
    • 2021-04-09
    120 min

    [MEYD-670]I Am Actually Continuously Getting Fucked By My Husband's Superior... Nanase Asahina

  • asahina nanase censoredcreampiesingle workMEYDtameike gorohirokoji osakiMEYD-670MEYD670meyd00670
    • 2021-04-14
    154 min

    [SSIS-040]Body Fluid Play With A Middle Aged Man, Highly SK**led Sex With 11 Cum Shots Yura Kano

  • yura kanno censoredblowjobbeautiful girlSSISs1 no 1 stylemon cSSIS-040SSIS040ssis00040
    • 2021-04-20
    78 min

    469G-627 #Saddle Girl Yui

  • amateur censoredcreampieuniformgg-627g627469g-627
    • 2021-04-22
    39 min

    FC2PPV 1782220 [No / Mufufu benefits available] The plump big breasts girl who sticks out the side milk likes cock more than electric massage! ？？ The practitioner’s thing is lively and SP massage is begging! * 3 major review benefits available

  • amateur uncensoredfc2
    • 2021-04-24
    34 min

    FC2PPV 1784966 [Individual shooting 36] Prefectural K ③ Active model Shaved ⑰ After midnight exposure wandering, vaginal cum shot in the men’s toilet

  • amateur uncensoredfc2
    • 2021-04-28
    43 min

    517MQXT-007 A Woman Who Faints When Her Nipples, Mako And Anal Are Blame At The Same Time

  • amateur censoredanalamateurmqxtmqxt-007mqxt007517mqxt-007
    • 2021-04-29
    50 min

    C0930 ki210429 Madoka Sekiguchi 38years old

  • amateur uncensoredc0930
    • 2021-05-01
    160 min

    [DVDMS-662]Smoking Hot Airport Security Guard Yuiko (Age 23) Makes Her Porn Debut - And Loses Her Virginity On Camera! A Working Girl's Porn Performance - This Slender, Toned Babe Has Defined Abs - 307 Days Of Passionate SEX

  • censoredamateurDVDMSdeep shikaru kamegashiraDVDMS-662DVDMS662dvdms00662
    • 2021-05-01
    189 min

    [BBAN-324]Female Teacher Lesbian Sex Servant H

  • yuri sasahara chiharu miyazawa censoredlesbianbdsmBBANbibianBBAN-324BBAN324bban00324
    • 2021-05-13
    95 min

    [MHAR-002](The Men's Massage Parlor Everybody's Talking About) Mature Woman Masseuse's Secret Raw Creampie SEX Options 2

  • censoredcreampieamateurMHARmilf laboMHAR-002MHAR002h-1160mhar00002
    • 2021-05-22
    61 min

    1Pondo 052221_001 Naughty Kiss and Fucking: Kana Takashima

  • amateur uncensored1pondo
    • 2021-06-16
    120 min

    [FOCS-003]A Sexually Aggressive Big Tits JD She Can No Longer Stand Being Deprived Of Sex By Her Boyfriend! She Loves To Give A Blowjob And She's Got A Bottomless Well Of Sexual Lust She Can Never Resist The Temptation To Have Sex, And Will Secre

  • censoredbig titsamateurFOCSabc mousouzokufocusFOCS-003FOCS003focs00003
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-14
    66 min

    494SIKA-100 Revenge On Your Boyfriend! Look At Me Squirming With Another Stick

  • amateur censoredcreampieamateursikasika-100sika100494sika-100
    • 2021-07-17
    152 min

    [CAWD-257]DMJD (A Reader Model College Girl) This Skinny Babe Is Getting Skewered By Big Thick Cocks And Sending Her AA-Cup Titties Twitching And Trembling Into Cum Crazy Ecstasy! Her Super Thin Body, Her Beautiful Legs, And Her Ultra Tight Pussy Are

  • hitomi hoshitani censoredcreampiesingle workCAWDkawaiiCAWD-257CAWD257cawd00257
    • 2021-07-17
    93 min

    FC2PPV 1927179 [Half Price] Until 7/25 ♥ Fit Samurai Signboard Girl ♥ Total Length 1 Hour 31 Minutes Recording [Appearance] [Nothing] [No ◎ Slope System] Premier Version With Unreleased Video Completely Recorded! Man Juice Dripping With A Trolley Is

  • amateur uncensoredfc2
    • 2021-07-27
    65 min

    SIRO-4482 [First Shot] [Yanagi Waist Back Thrust Back] [The Moment When A Girl’S Face Turns Into An Adult’S Face] A Life-Sized College Student Who Is Curious About Naughty Things. She Was Deceiving Her Embarrassment With A Smile, But She Ch

  • amateur censoredamateursirosiro-4482siro4482siro-4482
    • 2021-08-27
    129 min

    [BANK-051]Busty Wife Hot Spring Date, H Cup Misato Wants To Be Turned Into A Slut, 25 Years Old

  • censoredcreampiebig titsBANKma ko ginkoutakechanBANK-051BANK051h-1495bank00051
    • 2021-09-03
    119 min

    [CAWD-273]Yesterday I Found Out I Was Impotent, But My Wife Is Somehow 4 Months Pregnant..., Starring Mayuki Ito

  • maiyuki ito censoredcreampiesingle workCAWDkawaiihasami kukaCAWD-273CAWD273cawd00273
    • 2021-09-15
    135 min

    [OVG-182]Do You Like Blowjobs From My Older Stepsister, Who Loves Dicks？

  • kana morisawa kanako iioka natsu tojo censoredblowjobslutOVGglory questOVG-182OVG182ovg00182
    • 2021-09-17
    123 min

    [FOCS-023]Pro Support Girl [Maina Yuri] I Was Seduced By A Slut And Couldn"t Resist Her "If You Want To Fuck Me So Badly, Please Give Me Money"

  • yuuri censoredcreampiebig titsFOCSabc mousou zokufocusFOCS-023FOCS023focs00023
    • 2021-09-26
    61 min

    HEYZO 2619 Sex Spree With A Young Married Pregnant Ready Woman! – Hitomi Okano

  • hitomi okano uncensoredcreampiehandjobheyzo
    • 2021-09-27
    179 min

    [MDVHJ-038]I Can"t Tell Anyone... Who Could Have Imagined That I Was Being Fucked By My Daughter"s Husband... 5

  • good miki ryoko izawa miki yoshii naoko akase censoredMDVHJgurafiteijapanmovieMDVHJ-038MDVHJ03848mdvhj00038
    • 2021-10-04
    62 min

    543TAXD-001 Rina

  • amateur censoredcreampieamateurtaxdtaxd-001taxd001543taxd-001
    • 2021-10-09
    73 min

    FC2PPV 2320947 Meychan, An Active First-Year Student, Has Lost Communication. The Investigative Agency Has Moved.

  • amateur uncensoredfc2
    • 2021-10-23
    26 min

    FC2PPV 2367538 [No 〇 Positive] Support With Namba Apparel Clerk 〇

  • amateur uncensoredfc2



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download