creampie jav amateur pov office lady




FC2GMEMSDABVEMAMILKMIDESHKDAWDSANCAWDSSISSPRDCHRVAUKGPPPDDASDMIAAHNDVENUAMBIWANZ

2020-12-24
109 min

[SPRD-1361]From That Day When I slept Next To My Stepmom... Mio Morishita

  • mio morishita censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1361SPRD136118sprd01361
    • 2021-01-08
    240 min

    [SOUD-024]Adorable Short-Haired Beautiful Teens - Cute, Sexy Sex BEST Collection!

  • censoredamateurbeautiful girlSOUDprestigebest fuckingSOUD-024SOUD024118soud00024
    • 2021-01-08
    183 min

    [NHDTB-478]Annual Custom - Private School Senior's Culture Festival Booth Is Secretly A Swinger's Club

  • censoredschoolgirlNHDTBnatural highlemonheart nakajimaNHDTB-478NHDTB4781nhdtb00478
    • 2021-01-08
    125 min

    [GUN-846]Breast Milk Slut Ami Kasai

  • kami ami censoredcosplayslutGUNradixshio sakurababatsugun paradoxGUN-846GUN846433gun00846
    • 2021-01-14
    60 min

    SIRO-4396 [First shot] [Beautiful ass with sticky skin] [Embarrassing but not stopping ..] Every time she arouses shame, her over there tightens violently. Her cute face is distorted and the waves of cum that are repeated many times .. AV application

  • amateur censoredamateursirosiro-4396siro4396siro-4396
    • 2021-01-15
    240 min

    [MBM-259]"Let's Keep This A Secret From Your Stepdaddy..." When A Stepmom Bares Her "True Identity As A Woman" Our Stepdaddy Is Unaware Of Our Secret A Stepmom And Stepson, Engaged In A Forbidden Sexual Rhapsody 12 Ladies 4 Hours

  • censoredbig titsmature womanMBMprestigegaro sasazukambmMBM-259MBM259118mbm00259
    • 2021-02-11
    162 min

    [MIST-326]A Private Titty Pub The Club Was Suddenly Shut Down This Girl From The Club Said She Wanted To Meet With Me, Alone ... And So, Unbeknownst To The Club Owners, I Got To Fondle Those Titties And Have All The Creampie Sex I Wanted Mami Hoshino

  • mami hoshino censoredcreampiesingle workMISTmr michirusaitaMIST-326MIST3261mist00326
    • 2021-02-13
    117 min

    [VEC-465]The Married Woman Next Door Seduces Male Virgins With Her Teeny Tiny Panties & Front-Clasp Bra Mio Kimijima

  • kimishima mio censoredcreampiebig titsVECvenussarumegami venusVEC-465VEC465vec00465
    • 2021-02-18
    157 min

    [SSNI-996]It's Her First Anniversary Since Her Debut! She's Lifting Her Ban On Amateur Men! When She Takes Off Her Coat, She'll Be Hugging You Within 5 Seconds She's Going To Throw Herself Into Providing All The Hospitality She Can To

  • izuna maki censoredsquirtingsingle workSSNIs1 no 1 styleinaballSSNI-996SSNI996ssni00996
    • 2021-02-21
    119 min

    [CAWD-187]First Aphrodisiac Sex: Convulsive Sex With A Bilingual J-cup Female Teacher - Miku Maina

  • maina miku censoredbig titssquirtingCAWDkawaiikyoseiCAWD-187CAWD187cawd00187
    • 2021-02-22
    135 min

    [ANZD-063]"We Have To Feel Good Together" Submissive Girl With Big Tits Has Hard Convulsing Orgasm As She Serves Herself Up, Vigorously Sucking Dick And Getting A Creampie!

  • censoredcreampiebig titsANZDanzu daydream vacationanzuANZD-063ANZD063anzd00063
    • 2021-03-01
    120 min

    [NACR-405]A Father-in-law Who Fell In Love With His Son's Wife - Nozomi Higashi

  • nozomi higashi censoredcreampiemature womanNACRplanetshichidomeNACR-405NACR405h-237nacr00405
    • 2021-03-11
    58 min

    C0930 ki210311 Miyuki Takizawa 21years old

  • amateur uncensoredc0930
    • 2021-03-16
    59 min

    FC2PPV 1729300 First shot ❤️ 166/42 Good style reading Mo-chan and creampie SEX! 【selfie】

  • amateur uncensoredfc2
    • 2021-03-19
    63 min

    FC2PPV 1694498 [Limited quantity 2980pt → 1980pt] Legendary Pukuman ❤️ Active cosmetic surgery esthetician Kaho who was deceived by massage recruitment ❤️ Plump and thick Oma ○ This is a permanent preservation version Many purchase benefits

  • amateur uncensoredfc2
    • 2021-03-31
    59 min

    FC2PPV 1748356 A fashionable girl with green hair appears, a shy person, but a lot of disorder of personality sudden change, "Personal shooting" individual shooting original 115th person, raw squirrel

  • amateur uncensoredfc2
    • 2021-04-09
    28 min

    FC2PPV 1761642 [Personal shooting] Massive launch with a blowjob in the car of a transcendent beauty female college student Minami

  • amateur uncensoredfc2
    • 2021-04-09
    179 min

    [MIAA-420]My Girlfriend's Chubby Older Sister Opened Up My Ass And Made Me Cum Like A Woman Yuri Honma

  • really censoredbig titsslutMIAAmoodyznao masakieveryone s porn starMIAA-420MIAA420miaa00420
    • 2021-04-12
    70 min

    [SHH-020]Big Booty Massage Slut Rides Your Cock Cowgirl-Style While Your Wife Is Right Beside You! Cheating Creampie Sex At The Massage Parlor

  • censoredslutSHHnatural highkansukeSHH-020SHH0201shh00020
    • 2021-04-13
    138 min

    [KUSE-013]No Way I'd Ever Fuck Him! The Rookie Female Teacher In Charge Of The Swim Team Gets Slipped An Aphrodisiac To Make Her Horny For The Principal She Hates Yota Chan

  • chanyota censoredsingle workdramaKUSEsod createryo inugamithis actress style is amazingKUSE-013KUSE0131kuse00013
    • 2021-04-26
    64 min

    328HMDN-357 [Gachi Flirt] Kyoto’s Hannari Beautiful Wife 24 Years Old Called And Seeded While Shopping With Her Husband And Returned! De Nasty Slut Wife Who Makes A Call So That It Does Not Barre And Get Drunk With Convulsions Acme [Personal Sho

  • amateur censoredcreampiemarried womanhmdnhmdn-357hmdn357328hmdn-357
    • 2021-05-14
    160 min

    [DVDMS-667]I Was Robbed Of 16 Cum Shots Of My Semen During A Lovey-Dovey 2-Day, 1-Night Creampie Hot Spring Resort Vacation She Was An Adorable, Sweet Young Thing, Like An Angel Ichika Matsumoto

  • ichika matsumoto censoredcreampiebeautiful girlDVDMSdeep sostracismDVDMS-667DVDMS667dvdms00667
    • 2021-06-02
    123 min

    [GVH-245]A Father In Law And Daughter In Law, Engaged In Hard And Tight Creampie Sex Kanna Misaki

  • kanna misaki censoredcreampiegrandfatherGVHglory questtsunemori takahashiGVH-245GVH24513gvh00245
    • 2021-06-05
    115 min

    [KAGP-185]Corner Masturbation: I Can't Stop Once I Start Rubbing It 4 - 13 People

  • censoredamateurbeautiful girlKAGPkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGP-185KAGP185kagp00185
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-03
    42 min

    210AKO-431 YUKI 2nd shot

  • amateur censoreduniformamateurakoako-431ako431210ako-431
    • 2021-07-08
    190 min

    [HAWA-252]We Slipped An Amateur Married Woman One Condom And Gave Her A Night At Home With A Regular College Guy. But Once Is Never Enough, So She Let Him Creampie Her Cunt Twice! Meet Nanao: A 40-Something Married Woman With H-Cup Tits Who Likes To

  • censoredbig titsmature womanHAWAkosumosu eizoumountain moricosmospictures soft on demandHAWA-252HAWA2521hawa00252
    • 2021-07-09
    25 min

    FC2PPV 1911957 [Emergency 3 days only] (Leaked) Youth idol erotic leaked at a hotel on location [Caution to be deleted]

  • amateur uncensoredfc2
    • 2021-07-10
    255 min

    [MDTE-007]They Look So Cute You Won't Believe They're So Nasty - S********l Sugar Babies Spread Their Legs For Creampies! 4 Hours 3

  • censoredcreampieMDTEspace planningtetMDTE-007MDTE007mdte00007
    • 2021-07-10
    61 min

    BINI-291 Mayuri

  • amateur censoredanalamateurbinibini-291bini291bini-291
    • 2021-07-15
    95 min

    [AKDL-126]"Don't Put It In!" You Promised...Inserting It Raw Into The Moist Vagina Between Her Things I Fuck My Best Friend's Adorable Girlfriend Rua Takashiki

  • takashiki censoredcreampiedramaAKDLaquinoriaquinoriaknrAKDL-126AKDL1261akdl00126
    • 2021-07-17
    189 min

    [REXD-371]Fucked In Front Of My Boyfriend...Teacher On Patrol During The School Trip, "She Should Be Knocked Out, So There's No Way She'll Wake Up!"

  • censoredcreampieschoolgirlREXDredmanji groupREXD-371REXD371rexd00371
    • 2021-08-07
    100 min

    [VENX-066]突然押しかけてきた嫁の姉さんに抜かれっぱなしの1泊2日 小川華蓮

  • karen ogawa censoredcreampiemature womanVENXvenuskitano majimeincest vi nasuVENX-066VENX066venx00066
    • 2021-09-03
    81 min

    259LUXU-1471 Luxury TV 1452 A Man Who Has Been Around For Almost 3 Years A Beautiful School Teacher Makes An Emergency Av Appearance To Satisfy The Sexual Desire Accumulated In The Drought! The Sensitivity Of The Frustrated Body Is Outstanding! It Is

  • amateur censoredamateurluxuluxu-1471luxu1471259luxu-1471
    • 2021-09-04
    59 min

    1Pondo 090421_001 M Slut : MIki Hoshino

  • amateur uncensored1pondo
    • 2021-09-07
    61 min

    H4610 ki210907 Haruko Sone 26years old

  • amateur uncensoredh4610
    • 2021-09-17
    125 min

    [BLK-520]Sudden Reverse Pick Up Harlem Beach. Light Skin. Skinny Guys Like You Can"t Have Fun At The Beach, So Just Fuck Us Instead! Mao Hamasaki , Nozomi Arimura

  • hamazaki mao arimura nozomi censoredcreampieslutBLKkira kirasamoarikira hosi kira black galBLK-520BLK520blk00520
    • 2021-09-18
    130 min

    [SORA-335]Please Fuck Me In My Pussy Sumire Niwa

  • niwa sumire censoredsingle workdramaSORAyama to sorahimurokkuSORA-335SORA335sora00335
    • 2021-09-24
    36 min

    FC2PPV 2241687 980 Yen! [Exclusive Video Without 4k] 3 Consecutive 4P Vaginal Cum Shot! Fair-Skinned Plump H Cup Huge Breasts Ol Chihiro-Chan Chapter 21 _ Bonus

  • amateur uncensoredfc2
    • 2021-09-29
    65 min

    494SIKA-114 ●● 2sex With A Manicurist Who Has Blossomed Erotically

  • amateur censoredamateurbukkakesikasika-114sika114494sika-114
    • 2021-10-15
    118 min

    [MIAA-513][Mind-Blowing Pussy Orgasms] This Stepfather Gave His JD Stepdaughter Aphrodisiac-Fueled Piston-Pounding Strokes Into Her Pussy And Filled It With His Semen And Bodily Fluids Sweaty, Spasmic Sex With You, Filled With Squirting Orgasmic Ecst

  • ichika matsumoto censoredcreampiesquirtingMIAAmoodyzhata tairyouminna no kikatanMIAA-513MIAA513miaa00513
    • 2021-10-16
    109 min

    390JAC-112 [Molester Desire X Beautiful Breasts E Cup X Continuous Squirting] A Frustrated Married Woman Who Is Delusional Every Day! She Gets On The Ethical-Ignoring Molester Train "Siko Siko TRAIN" That Suddenly Appears There! Gachigachi ●

  • amateur censoredcreampiemarried womanjacjac-112jac112390jac-112
    • 2021-10-16
    122 min

    [MRSS-124]I Promised To Protect My Wife For As Long As She Lived, But She Got Fucked By A Stalker Yu Shinoda

  • shinoda yu censoredcreampiebig titsMRSSmisesu no sugao emanuelyumesaki ichiroumisesu no sugaoMRSS-124MRSS124mrss00124
    • 2021-10-27
    38 min

    FC2PPV 2377322 [38 Minutes 3 Shots] A Younger Sister Who Is Very Similar To The Actress Passed The Interview. Uncut 3 Shots Cum Swallowing. Cum Circle ＃ 17

  • amateur uncensoredfc2
    • 2021-12-17
    45 min

    FC2PPV 2522099 First Shot! !! Limited Number! [Uncensored] Creampie Twice To A Gorgeous Active Beauty College Student Gcup Beauty With High Pride! !! (Feature Film)

  • amateur uncensoredfc2
    • 2021-12-23
    57 min

    10musume 122321_01 A Girl is Scribbled All Over Her Body but She Still Gets Horny Rikako Yamada

  • amateur uncensored10musume
    • 2022-01-07
    118 min

    [SSIS-292]Madonna (Beauty) Who Used to Bully Me is Now a Rich Celebrity"s Wife...After I Witnessed Her Having an Affair, I Could Fuck Her As Much As I Wanted. Marin Hinata

  • marin hinata censoredbig titssquirtingSSISs1 no 1 styletiger kosakaiSSIS-292SSIS292ssis00292
    • 2022-01-08
    120 min

    [MDTM-753]After A Work Party I Took My Employee To A Hotel And We Had Wild Adulterous Sex All Night Until The Sun Rose Marina Saito

  • marina saito censoredcreampiesingle workMDTMuchu kikakutodoMDTM-753MDTM753mdtm00753



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download