creampie big tits married woman amateur jav




FC2PPPDBBANAUKSAUKGPREDMIAAADNNACRNATRSQTEMVSDSHKDHNDMIDEAMBIGVHMEYDDASDMARAEBOD

2021-01-02
66 min

200GANA-2418 Seriously Nampa, first shot. 1577 I want to post a review of health appliances on Yo ● Tube! When I hit the girl’s bar clerk who picked up in Shinjuku with an electric massage machine …？ Succeeded in shooting erotic videos that

  • amateur censoredbig titsamateurganagana-2418gana2418200gana-2418
    • 2021-01-08
    41 min

    [SDFK-040]"Couples Only" In The Magic Mirror Number, "Please Fuck My Girlfriend" Real Creampie! Minami, 21, College S*****t

  • censoredSDFKsod createyoshiaki nomotomagic mirrorSDFK-040SDFK0401sdfk00040
    • 2021-01-09
    76 min

    300MAAN-615 [Boyish Bishoujo JD / Kitsuman Masterpiece / Sweaty Creampie] 19-year-old basketball club member, active JD Suzu-chan! A healthy slender beauty BODY that has been refined through daily training! Despite its boyish appearance, it has a sen

  • amateur censoredcreampieamateurmaanmaan-615maan615300maan-615
    • 2021-01-13
    43 min

    230ORE-742 A sensei

  • amateur censoredcreampiebig titsoreore-742ore742ore-742
    • 2021-01-21
    122 min

    [HBAD-572]The Mother Tolerates Her Stepdaughter Being Sacrificed As A Meat Toy To Men - Sara Kanami

  • kagami sara censoreddeepthroatbdsmHBADhibinonamitaro umababeHBAD-572HBAD5721hbad00572
    • 2021-01-23
    139 min

    [DASD-808]When Her Husband's Away, She Invites Men Into Her Home She's Super Horny And Letting Her Lust Explode As She Pants And Moans With Pleasure Usually, She's A Seemingly Graceful Young Peach Of A Wife, But In Reality, She's A Lo

  • censoredcreampieDASDdasDASD-808DASD808dasd00808
    • 2021-01-30
    118 min

    [WAAA-033]My Sexy, Voluptuous Lady Boss Planned To Have Me Booked In The Same Room With Her So She Could Feast On My Cock In A Reverse NTR Fuck Fest She Extracted 10 Cum Shots From Me With Her Voluptuous Titties And Big Ass In A Creampie Full Court P

  • sayama love censoredcreampiebig titsWAAAwanz factorywanzWAAA-033WAAA033waaa00033
    • 2021-01-30
    149 min

    [MIAA-380]Busty Wife Gets Fucked By Her Husband`s Hated Boss All Over Again Hikari Sena

  • hikari sena censoredcreampiesingle workMIAAmoodyzzaku araieveryone s porn starMIAA-380MIAA380miaa00380
    • 2021-02-15
    58 min

    328HMDN-337 Double Demon Cock x Married Woman] 3P Seeding Edition ● 30-year-old university clerk’s married woman Misaki (pseudonym) Excited about her first 3P experience. The big cock of Gorigori is skewered up and down and pistoned and convulsi

  • amateur censoredcreampiebig titshmdnhmdn-337hmdn337328hmdn-337
    • 2021-02-18
    57 min

    [oretd-843]NARUMI

  • amateur censoredcreampieuniformoretdoretd-843oretd843oretd-843
    • 2021-02-18
    70 min

    [SIROR-050]Rent-A-MILF - The Hidden Side Of Mature Wives Their Husbands Never See File. No. 50 -

  • censoredcreampiebig titsSIRORdispatched.comSIROR-050SIROR050h-1492siror00050
    • 2021-02-22
    133 min

    [SRMC-029]It Can't Be True That You Can Make Sex Feel 100 Times Better Just Through The Power Of Suggestion! 2 Mizuki Yayoi

  • mizuki yayoi censoredsquirtingbeautiful girlSRMChypnosisrusher miyoshiSRMC-029SRMC029srmc00029
    • 2021-02-28
    140 min

    [KTKL-096]Incredibly Beautiful Y********l Who Auditioned For That Super Popular Idol Group And Almost Made It In Makes Her Dengeki AV Debut - Kurumi Himejima

  • himejima walnut censoredbeautiful girlsingle workKTKLkittyxhearthKTKL-096KTKL096ktkl00096
    • 2021-03-05
    37 min

    FC2PPV 1713115 [Uncensored / Individual shooting] * Bring your best friend’s sister to the hotel … forcibly vaginal cum shot.

  • amateur uncensoredfc2
    • 2021-03-08
    44 min

    302GERK-354 Ichika

  • amateur censoredcreampieamateurgerkgerk-354gerk354302gerk-354
    • 2021-03-12
    44 min

    [CLO-136]Uniform Trial - Hinata Suzuki

  • suzumori hinata censoreduniformblowjobCLOchobitchchovicCLO-136CLO136h-1435clo00136
    • 2021-03-12
    41 min

    [tyvm-139]かおり(38)

  • amateur censoredcreampiesquirtingtyvmtyvm-139tyvm139tyvm-139
    • 2021-03-23
    61 min

    Caribbeancom 032321-001 Facial & Mouth Cunshot For Non Suzumiya

  • non suzumiya uncensoredcreampiehandjobcaribbeancom
    • 2021-03-26
    39 min

    480FRIN-025 《Personal shooting》 Entertainment talent Idol 1 ● years old Entertainment class Pillow SEX outflow with serial drama producer

  • amateur censoredcreampieamateurfrinfrin-025frin025480frin-025
    • 2021-03-27
    136 min

    [KNMB-011]Totally Raw STYLE @ Rimi #Half-In, Half-Out #G-Cup Colossal Tits #True Nature #Her First Slutty Video #Busty S********l #Cum-Swilling Pussy #Sugar Babe #Creampie Rimi Momono

  • rimi momono censoredcreampiebig titsKNMBfirst star100 raw styleKNMB-011KNMB011h-491knmb00011
    • 2021-04-15
    66 min

    SIRO-4430 [First shot] [Talented] [Continuous climax] A tall beautiful woman who dies many times while shaking soft F milk. Etch after a long time is more pleasant than I expected .. AV application on the net → AV experience shooting 1508

  • amateur censoredbig titsamateursirosiro-4430siro4430siro-4430
    • 2021-04-15
    65 min

    336KNB-150 I Can’t Be Satisfied With Sex With My Husband And Apply For AV! Contrary to the appearance that seems to be an adult, the sensitivity is good and the intense erotic reaction! !! A mysterious wife who trembles with a pleasant sensation

  • amateur censoredbig titsmarried womanknbknb-150knb150336knb-150
    • 2021-04-15
    122 min

    [TIKB-107](Mind Officially Blown) Cock-Loving Slut With Big Tits And A Huge Booty Takes An Aphrodisiac That Gives Her A Total Nympho Meltdown - Transformed Into A Kinky Sexy Goddess REMI

  • remi censoredcreampiebig titsTIKBchikikikikama delusion groupTIKB-107TIKB107tikb00107
    • 2021-04-22
    124 min

    [FSDSS-210]I Am A Slut Beautiful Y********l Makes Older Men Cum Over And Over Yui Shirasaka

  • yui shirasaka censoredblowjobbeautiful girlFSDSSfalenoboomer 44faleno starFSDSS-210FSDSS2101fsdss00210
    • 2021-04-24
    134 min

    [SQTE-366]I Told You She'd Let You Creampie Her. Suzu Monami / Minami Saito / Rika Aimi

  • monami bell rumi tadami censoredcreampieblowjobSQTEs cuteSQTE-366SQTE366sqte00366
    • 2021-05-15
    77 min

    229SCUTE-1118 Maron (24) S-Cute God Breasts Beautiful Body Too Lively Sexual Intercourse

  • amateur censoredcreampiebig titsscutescute-1118scute1118229scute-1118
    • 2021-05-22
    63 min

    10musume 052221_01 When I was playing with a dick with a sex toy, my body was burning Yuko Ikeda

  • amateur uncensored10musume
    • 2021-05-28
    92 min

    300MIUM-714 Big Tits Yariman World ◯ Amber! !! !! [Fleshy soft skin H cup big breasts x plump whip beauty big butt] x [Experienced gal with more than 3 digits of experience to drink! !! !! ] × [Premature ejaculation torotoma full of lust ● If you pus

  • amateur censoredbig titsamateurmiummium-714mium714300mium-714
    • 2021-06-11
    74 min

    328HMDN-371 [Personal shooting] Gonzo with a married woman (32 years old) with SEX addiction. A horny hole that cums just by inserting it. Cheating wife who is disturbed by white eyes while squirting

  • amateur censoredcreampiemarried womanhmdnhmdn-371hmdn371328hmdn-371
    • 2021-06-12
    48 min

    519MAZOF-002 [Inevitable browsing] Psychiatrist ♀ 33 years old A teacher who is crazy with an ahegao face that can not be seen by patients at night, even though he is calm in counseling. The uterus is crushed by a vibe and she has white eyes in the b

  • amateur censoredamateurslutmazofmazof-002mazof002519mazof-002
    • 2021-06-17
    121 min

    [MKON-055]My C***dhood Friend Who Has A Stalker Asked Me To Be Her Bodyguard When She's Leaving School Natsu Tojo

  • natsu tojo censoredcreampieschoolgirlMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-055MKON055mkon00055
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-29
    137 min

    [KMHRS-045]Girl Attracted To Ennui Masturbates Every Day But It's Still Not Enough Antisocial Pervert Who Longs For A Social Butterfly AV debut Noeru Honda

  • honda noeru censoredamateursingle workKMHRSsod createeasy matsumotoi fell in love with youKMHRS-045KMHRS0451kmhrs00045
    • 2021-07-01
    55 min

    Caribbeancom 070121-001 Beautiful lady’s virgin anal Nana Kamiyama

  • nana kamiyama uncensoredanalcreampiecaribbeancom
    • 2021-07-10
    158 min

    [SABA-710]Sharing A Hotel Room With My Coworker After We Went Out And Missed The Last Train... She Seemed So Unguarded, I Couldn't Resist Her... vol. 010

  • censoredcreampieamateurSABAskyu shirototodoSABA-710SABA710saba00710
    • 2021-07-20
    65 min

    FC2PPV 1932302 * Limited To 3 Days 2980⇒1980pt ★ First Shot Amateur ☆ Fierce! Geki Iki Musume ♥ Highly Educated Jd Izumi-Chan 21 Years Old With Beautiful Breasts Nice Body ♥ Super Sensitive Erotic Daughter ♥ Continuous Iki Of Raging ♥ Cum Shot At The

  • amateur uncensoredfc2
    • 2021-07-29
    92 min

    [FUGA-049]The Wife Who Will Fuck The Criminal To Get Back Her K****pped Husband: Yuka Mizuno

  • yuka mizuno censoredcreampiemarried womanFUGAcenter villagejiro fukagawaparadise center villageFUGA-049FUGA049h-086fuga00049
    • 2021-08-07
    161 min

    [XRLE-014]A Perverted Housewife That Feels Pleasure From Anal Has A Developed Ass-Pussy. Mayu(Alias) 28 Years Old

  • censoredanalcreampieXRLEk m producesugino kireal real worksXRLE-014XRLE014xrle00014
    • 2021-08-12
    241 min

    [NHDTB-560]CA Airplane Pervert 7: Gorgeous Edition Creampie Specials

  • censoredcreampiesquirtingNHDTBnatural highitaka smithlin powderNHDTB-560NHDTB5601nhdtb00560
    • 2021-08-13
    119 min

    [PPPD-951]We"ll Send You The Big Tits Ex Sports Commentator Bitch That Gives You Titty Fuck Blowjobs Instantly. Reona Tomiyasu

  • takehiro tomiyasu censoredcreampiebig titsPPPDoppaiPPPD-951PPPD951pppd00951
    • 2021-08-16
    71 min

    [MISG-003]Creampie Sex With A Girl Who Is Annoyed For Some Reason And Treats Me Coldly Yu Shinoda

  • shinoda yu censoredcreampiebig titsMISGstimulation strongjohnny shibuyaMISG-003MISG003misg00003
    • 2021-08-21
    95 min

    [AGMX-088]Giving My Finger So Many Blowjobs That I Can Watch Her Saliva Dripping

  • nene tanaka aya mamiya censoredbig titsbeautiful girlAGMXsex agentyuuki mogeraAGMX-088AGMX088agmx00088
    • 2021-08-24
    150 min

    [KUSE-026]Amateur Demands Her Favorite Dicks For A Blowjob Home Visit! Unexpected Creampie For First-time Sex？! Plenty Of Cum In This All Out Sex Fest On Camera. 7x Dicks, 12x Cum Shots, 11x Cum Swallowing! Minami Iroha

  • minami iroha censoredcreampieamateurKUSEsod createichinose kurumijoyuu no kuse ga sugoiKUSE-026KUSE0261kuse00026
    • 2021-09-02
    92 min

    [HTHD-190]My Friend"s Mother - Last Chapter - Saki Oishi

  • saki oishi censoredcreampiemature womanHTHDcenter villagemitsusato koutarouhanazono center villageHTHD-190HTHD190h-086hthd00190
    • 2021-09-03
    122 min

    [JUTA-121]The Best!! An AV Document Of The First Undressing Of A Fifty-Something-Year-Old Wife, Akari Maya

  • shinya akari censoredcreampiemature womanJUTAjuku onna japan emmanuellekongouriki marujuku onna japanJUTA-121JUTA121juta00121
    • 2021-09-05
    61 min

    Caribbeancom 090521-001 Creampie With An Ideal Mistress Beautiful Big Breasts Beauty Every Day Mika Sumire

  • mika sumire uncensoredcreampiecaribbeancom
    • 2021-09-11
    119 min

    [LUNS-080]60 Something Doggy Style 11

  • censoredcreampiemature womanLUNSluna shunkoushaLUNS-080LUNS080luns00080
    • 2021-09-17
    73 min

    230OREC-880 Maika

  • amateur censoredcreampieamateurorecorec-880orec880230orec-880



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download