come




FC2WANZDASDONEZVENUSANKSBJSSISJUFEBBANSSNIABWMVSDMIDEFSDSSGMEMSPRDGVHMIDVNACXATID

2020-09-18
132 min

[BIJN-185]The Documentary Basic Instinct Baring Orgasmic Sex A Voluptuous And Meaty Perverted Young Wife Manami Oura

  • manami oura censoredcreampiebig titsBIJNbijin majo emmanuelleBIJN-185BIJN185bijn00185
    • 2020-09-21
    130 min

    [KATU-074]Hard Nipples Super Slutty Bar Hostess Huge Tits Big Ass Who Loves Fucking Shaved Aggressive Slut

  • censoredbig titsslutKATUkatsuo bussan mousouzokumaglowKATU-074KATU074katu00074
    • 2020-09-27
    71 min

    300NTK-440 Infinite ∞ tide! !! Beautiful girl gal appears! !! How many liters! ？？ Unmeasurable bed flood damage tremendous squirting whale bitch beautiful girl! !! Saddle tide spouts while wiping the tide pool while being pistoned by standing back! !

  • hgal censoredsquirtingamateurntkntk-440ntk440300ntk-440
    • 2020-10-03
    208 min

    [URE-059]A Madonna Exclusive Hikari Kisaki Her First Mature Erotic Comic Adaptation!! This Is A Faithful Live Action Adapatation Of The Sequel To The Hall-Of-Fame NTR Masterpiece, "An NTR City Tour With A Married Woman"!! Based On The Origina

  • hikari hime yoshine yuria censoredbig titsmature womanUREmadonnakitorune kawaguchiure.comiURE-059URE059ure00059
    • 2020-10-21
    54 min

    FC2PPV 1541848 My future dream is a beautician ❤️ An active beauty student with big eyes and beautiful F cup beautiful breasts ❤️ On the verge of exploding with a soft F cup fucking ❤️ A large amount of vaginal cum shot in a sensitive shaved pussy th

  • amateur uncensoredfc2
    • 2020-10-22
    122 min

    [GS-360]An Alluring High-Class Cabaret Girl A Young Hostess Princess Doesn't Have Time To Do Household Chores, So I Was Hired To Do The Cooking And Cleaning For Her. And Since She's One Of Those Women Of The Night, She Was Beautiful And Sexy!

  • censoredcreampieGSsosoru x garconspada ikebukuroGS-360GS3601gs00360
    • 2020-10-23
    44 min

    [BTH-078]Cherry Boy Fan Thanksgiving Day - Riku Minato

  • eternal censoredcosplaybeautiful girlBTHchobitchchovicBTH-078BTH078h-1435bth00078
    • 2020-11-08
    73 min

    AVHD-101 Erika

  • amateur censoredamateurblowjobavhdavhd-101avhd101avhd-101
    • 2020-11-11
    60 min

    468NRPK-007 Akemi

  • amateur censoredmarried womanamateurnrpknrpk-007nrpk007468nrpk-007
    • 2020-11-11
    21 min

    FC2PPV 1566494 * 1800pt → 900pt [Limited quantity] GOT 〇 Affair activity. Saddle naked on the balcony of the hotel, then bring in separately and convulsions with a squirting piston

  • amateur uncensoredfc2
    • 2020-11-13
    240 min

    [MBM-234]Generating Fantastic Sales On Streaming Websites Legendary Housewife Pick Up Godlike Films Best Selection 04 12 Girls 4 Hours

  • censoredcreampieamateurMBMprestigegaro sasazukambmMBM-234MBM234118mbm00234
    • 2020-11-17
    25 min

    FC2PPV 1572797 Limited to 2 days [Individual] Mother of two big tits, being fucked and polluted by two strangers in a row

  • amateur uncensoredfc2
    • 2020-12-15
    197 min

    [PYM-360]Cock-Crazed Extreme Orgasms, Hard Piston Dildo Masturbation

  • censoredPYMprimoPYM-360PYM360h-283pym00360
    • 2020-12-17
    120 min

    [OKSN-311]Three-Way With Stepson's Friends! Horny MILF's Lust Unleashed - Young Cocks Seduced By A Passionate Blowjob!

  • censoredmomOKSNabc mousouzokuokasan.comOKSN-311OKSN311oksn00311
    • 2020-12-18
    82 min

    259LUXU-1352 Luxury TV 1341 H-cup dental hygienist with 1 experienced person debuts! !! A glamorous sensitive body that makes you feel too much after having sex for the first time in a long time. Instinct full-throttle obscene sexual intercourse that

  • amateur censoredbig titsamateurluxuluxu-1352luxu1352259luxu-1352
    • 2020-12-21
    125 min

    [ZKWD-015]After School Sluts - Slut 15 Noa Nonomura

  • nonomura censoredbig titssingle workZKWDtoyohikozarakiseiunkaiZKWD-015ZKWD015zkwd00015
    • 2020-12-21
    85 min

    [ZOZO-032]Minami Saitou

  • minami saito censoredZOZOsadistic villageZOZO-032ZOZO0321zozo00032
    • 2020-12-25
    123 min

    [VDD-168]Receptionist In... (Coercion Suite) Yuwa Kiriyama

  • kiriyama yuu censoreddeepthroatbdsmVDDdream tickettakuanvivid dream ticketVDD-168VDD16824vdd00168
    • 2021-01-08
    162 min

    [MIST-323]Hit That Shit On Her Danger Day! You Can Have Babymaking Sex At This Soapland 26 Mr. Michiru 5th Year Anniversary Exclusive Actress Audition: Judging The Acting Category Saryu Usui Shoko Akase Mizuki Yayoi

  • sakisui naoko akase censoredbig titsbeautiful girlMISTmr michirusaitaMIST-323MIST3231mist00323
    • 2021-01-21

    S-Cute 808_aika_02 Cunnilingus to a slender shaved girl / Aika

  • aika censoredamateuraikaaika-02aika02808-aika-02
    • 2021-02-11
    40 min

    [GRMO-022]ホテル盗撮 バンドマンとファンの女が、ライブ後禁断の密会をしコスプレSEXで二人きりの打ち上げ

  • censoredGRMOmura chblood clam abaloneGRMO-022GRMO022h-1534grmo00022
    • 2021-02-22
    63 min

    499NDH-002 [Urgent coverage] SEX out in an affair in exchange for a reward! In fact, a naughty married woman whose sexual desire explodes in a long time SEX [Translation Ali debt wife case 1]

  • amateur censoredcreampiemarried womanndhndh-002ndh002499ndh-002
    • 2021-02-24
    64 min

    FC2PPV 1700163 [1st Anniversary & 10,000 Comments Thanks] First Shooting & G Cup (100cm) Former S Idol is inexperienced and has 5 consecutive cum swallowing circle 10 Miyuki

  • amateur uncensoredfc2
    • 2021-03-01
    303 min

    [DOKS-538]For Discerning Pantyhose Fanciers - Magazine Models With Beautiful Legs' Masturbation In Glistening Pantyhose BEST Collection 5 Hours

  • yumi konomi nao tachibana nauri uehara censoredslutDOKSoffice k sseichu matsumotoDOKS-538DOKS53836doks00538
    • 2021-03-06
    60 min

    200GANA-2442 Seriously Nampa, first shot. 1606 Call out to a female college student who lacks sleep, Why don’t you try a good sleep pillow？ ⇒ Hotel IN! The pillow becomes an actor’s arm pillow before you know it! The humble girl is complete

  • amateur censoredamateurganagana-2442gana2442200gana-2442
    • 2021-03-12
    88 min

    TNS-001 Sara

  • amateur censoredamateurtnstns-001tns001tns-001
    • 2021-03-21
    240 min

    [HNDB-188]Endless G*******g Getting Fucked By The Worst Kind Of Men Female Fall From Grace Getting Pussy Filled With Cum 112 Times

  • censoredcreampieHNDBbookHNDB-188HNDB188hndb00188
    • 2021-04-21
    53 min

    481SACZ-018 Airi 2

  • amateur censoredamateurbdsmsaczsacz-018sacz018481sacz-018
    • 2021-04-23
    93 min

    380SQB-098 Shizuku

  • amateur censoredsquirtingamateursqbsqb-098sqb098380sqb-098
    • 2021-05-07
    143 min

    [IPX-652]Cheating On A Work Trip: Hot Female Employee Made To Cum By Her Hung Boss Miu Shiromine

  • shiramine miu censoredblowjobsingle workIPXidea pocketbungo maedadishIPX-652IPX652ipx00652
    • 2021-05-07
    153 min

    [MIFD-156]Nihao, Amateur Half-Taiwanese Girl Makes Her Climax Porn Debut! Meru Ito

  • ito meru censoredbeautiful girlsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-156MIFD156mifd00156
    • 2021-05-22
    279 min

    [NSPS-997]She Looks Meek But You Won't Believe How Crazy Her O-Face Looks! Hotaru Mori BEST

  • hotaru mori censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-997NSPS997nsps00997
    • 2021-05-22
    151 min

    [JUKF-063]Luckless College Girl Made To Pay Off Her Father's Debts - With Her Body - Kanna Kanna Misaki

  • kanna misaki censoredbig titssingle workJUKFjumpjump avJUKF-063JUKF063h-227jukf00063
    • 2021-05-27
    105 min

    [SPRD-1416]This Is Much Better Than My Husband's... Honoka Nakayama

  • hoka nakayama censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1416SPRD141618sprd01416
    • 2021-06-20
    132 min

    [MGMQ-075]My Curvy Teacher Turned Me Into An Ass Man - Orgasmic Anal Teasing Mearii Tachibana

  • tachibana mary censoredanalslutMGMQmegamithe beautiful goddess queenMGMQ-075MGMQ075mgmq00075
    • 2021-06-22
    57 min

    324SRTD-0231 Creampie For A Drunk Girl! / Sudden change when a girl who is drunk and has no resistance feels! He laughed and forgave me for vaginal cum shot

  • amateur censoredcreampieamateursrtdsrtd-0231srtd0231324srtd-0231
    • 2021-07-16
    75 min

    444KING-042 Mari

  • amateur censoredcreampiesquirtingkingking-042king042444king-042
    • 2021-07-20
    120 min

    [SPZ-1110]Completely Unexpected! Special Collection Of Hardworking Older Women Who Open Up Their Legs When Asked!

  • censoredcreampieuniformSPZstar paradisestar paradiesSPZ-1110SPZ1110h-254spz01110
    • 2021-07-22
    74 min

    FC2PPV 1935465 [Complete Amateur 114] Jd Ako 20 Years Old, Loss Of Genuine Virginity, Premium 4k

  • amateur uncensoredfc2
    • 2021-07-30
    183 min

    [PRED-327]Adult Video Debut Of A Former Announcer For A Local Broadcast Station. Sakura Yoda.

  • sakura yoda censoredsingle workPREDpremiumusapyonbd elegancePRED-327PRED327pred00327
    • 2021-08-21
    149 min

    [APKH-184]Mating With A Beauty In A Love Hotel A Beautiful Face But With Nasty Pubic Hair! Personal Sex Tape Of My Immoral Relations With A Female S*****t Who Loves Older Men And Begs For A Creampie. Suzu Takayama

  • takayama tin censoredcreampieschoolgirlAPKHaurora project annexhAPKH-184APKH184apkh00184
    • 2021-08-21
    64 min

    FC2PPV 2056783 [No] Creampie From A Toy Attack On A Slender Little Teen Who Is Cute To The Angel Class

  • amateur uncensoredfc2
    • 2021-09-03
    41 min

    480FRIN-048 《Personal Shooting / Hidden Shooting》 Entertainment / Model 20 Years Old Height 170cm Private Outflow There Is No Doubt That It Will Be A Hit With Reiwa Star Actress’s Egg Selling Actress’s Gateway To That Drinking Water Cm (Nan

  • amateur censoredcreampieamateurfrinfrin-048frin048480frin-048
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-10-07
    149 min

    [SW-805]No Bra On This Big Tits Waitress That Has Her Nipples Poking Out For Full Temptation! Seeing These Tits Will Turn You Into A Repeat Customer For This Lewd Service!

  • censoredbig titsSWswitchcambridgeswitch hibinoSW-805SW8051sw00805
    • 2021-10-21
    101 min

    [REBD-596]Aika 2 - The White Dancing Princess Of The Ryukyus - Aika Yamagishi

  • aika yamagishi censoredsingle workREBDrebeccakawaREBD-596REBD596h-346rebd00596
    • 2021-10-23
    252 min

    [MDBK-203][Total POV x Big Tits] No. 1 Titty Lover Satisfaction, Intense Titty Play Highlights

  • kurata mao hasumi claire censoredbig titsMDBKbazookataro kMDBK-203MDBK203mdbk00203
    • 2021-10-29
    122 min

    [MIAA-516]Sudden Street Corner Nipple Restraint Trans BDSM. I"ll Restrain You So You Can"t Move And Play With Your Nipples! Mei Satsuki, Kasumi Tsukino.

  • satsuki mei kasumi tsukino censoredcreampiebig titsMIAAmoodyzsamoariminna no kikatanMIAA-516MIAA516miaa00516



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download