censored lingerie jav nasty hard




FC2DASDCAWDONEZCESDKSBJDASDCJODHMNNNPJHUNTBVEMADTTMEYDMIDEAVSAMARASHKDPREDADNEBOD

2020-10-07
60 min

345SIMM-524 Yuki-chan / 18 years old / Imadoki J ● The contents are naughty even with a beautiful black-haired girl

  • amateur censoredcreampieuniformsimmsimm-524simm524345simm-524
    • 2020-10-17
    119 min

    [SSNI-897]Tiny Cutie Spends The Night With Her Huge Boss On A Business Trip And Ends Up Getting Bred Until Dawn Izuna Maki

  • izuna maki censoredbeautiful girlsingle workSSNIs1 no 1 stylerokusaburo mishimaSSNI-897SSNI897ssni00897
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-11-13
    132 min

    [SCOP-693]This Delivery Girl Breathed In The Aphrodisiac Smoke We Had Installed Into This Delivery Box, And When We Went Over To Pretend To Help Her, The Effects Of The Smoke Worked Like A Charm, And She Was No Super Sensual And Ready To Fuck From A

  • censoredcreampieSCOPscooplemon matsubaramousouzokuSCOP-693SCOP693h-565scop00693
    • 2020-11-13
    52 min

    [NTTR-054]A Predatory Player Who Likes To Go On The Hunt Has Possessed Asumi Yoshioka's Body! When Her Boss Came Over To Check On Her, He Used Her Body To Fuck His Brains Out, And Got So Hooked On Female Sensuality, He Started Cumming Like Crazy!

  • yoshioka asuka censoredbig titsNTTRsod createben katoknotriNTTR-054NTTR0541nttr00054
    • 2020-11-19
    118 min

    [PPPD-884]My C***dhood Friend With Big G-Cup Tits Became A Callgirl Known For Her Great Titty Fucks - Now We're Going To Live Together For 3 Days, No Restrictions On Cumming! Nene Tanaka

  • nene tanaka censoredcreampiebig titsPPPDoppaiPPPD-884PPPD884pppd00884
    • 2020-11-19
    163 min

    [AKDL-065](Couple NTR) S******g With A Girl In Front Of Her Boyfriend (Age 22 General Goods Store Employee Minami-san )

  • censoredamateurblowjobAKDLaquinoriaquinoriaknrAKDL-065AKDL0651akdl00065
    • 2020-11-28
    72 min

    [ssan-012]まこさん

  • amateur censoredbig titsamateurssanssan-012ssan012ssan-012
    • 2020-12-07
    83 min

    259LUXU-1349 Luxury TV 1336 Masturbation frequency twice daily! ？？ Is it the nature of the job of a nurse who has few encounters？ Pay attention to the appearance that the sexual desire that can not be resolved is disturbed only with Hara-san!

  • amateur censoredamateurluxuluxu-1349luxu1349259luxu-1349
    • 2020-12-14
    67 min

    FC2PPV 1606858 [First time limited 1980] Pure girls who worked at the airport take a gonzo because of hardship ❤️ 20-year-old Wakeari beauty ❤️ Insert an old man meat stick into a young pussy with strong vaginal pressure ❤️ Raw vaginal cum shot in th

  • amateur uncensoredfc2
    • 2020-12-24
    483 min

    [SHIC-198]Adolescence.com Adolescent Fiction 8 Hours The Best

  • censoredcreampiebig titsSHICadolscence.comSHIC-198SHIC198h-839shic00198
    • 2020-12-25
    56 min

    FC2PPV 1620164 [First time limited 1980] Serious beautiful wife who usually works at Su ○○ station ❤️ Actually it was sexless for 6 years ❤️ A married woman who is hungry for libido is rolled up with an electric massage machine, a vibrator and anothe

  • amateur uncensoredfc2
    • 2020-12-26
    172 min

    [JUFE-238]She's Wearing Tight, Fetishistic Clothes That Heighten Her Big Tits, Her Beautiful Legs, And That Amazing Body To The Upper Limit Of All That Is Possible, And Now You Get To Have Fully Clothed Sex With her Miyabi Midorikawa

  • midorikawa miyabi censoredbig titssingle workJUFEfitchmichiru arashiyamaJUFE-238JUFE238jufe00238
    • 2021-01-01
    59 min

    10musume 010121_01 A popular bunny cosplay escort girl who even does a cleaning blow job on New Year Day Sanae Kiuchi

  • amateur uncensored10musume
    • 2021-01-04
    53 min

    FC2PPV 1632025 ■ Limited to 100 first editions ■ [Opening] A sincere request. You only have to do it once. Please watch the sample. It’s like everyone falls in love. Such a girl. Premier video that can only be seen here ≪ №85≫

  • amateur uncensoredfc2
    • 2021-01-09
    115 min

    [DASD-794]CLose Up. Shemale Squeen Mayumi Harukaze

  • spring wind mayumi censoredsingle workDASDdashajime yanaiDASD-794DASD794dasd00794
    • 2021-01-09
    121 min

    [MIDE-869]"You Want Me To Suck You Off, Mister？" Blowjob-Loving S********l In Uniform Swallows Older Guys' Rods Until They Blow! Rikka Ono

  • rokka ono censoredschoolgirlblowjobMIDEmoodyzsuisei akaimoodyz divaMIDE-869MIDE869mide00869
    • 2021-01-12
    108 min

    [HONB-202]Slime-Slathered Huge Tits - G-Cup Slut

  • censoredbig titsamateurHONBmercurythe first shibuya special f e headquarHONB-202HONB202h-1133honb00202
    • 2021-01-13
    85 min

    435MFC-071 [Shiroto Gonzo] Nocha / 24 years old / Female teacher * Gonzo with a duero teacher who turns into an unequaled monster with a sexual desire even though she has a loli face! Rich 2 consecutive SEX with vaginal cum shot & nice ass launch

  • amateur censoredcreampieamateurmfcmfc-071mfc071435mfc-071
    • 2021-01-21
    32 min

    FC2PPV 1654058 [No] Fair-skinned slender daddy active woman. Grasp the weakness and threaten to inject the gene into the raw vagina

  • amateur uncensoredfc2
    • 2021-01-22
    121 min

    [DFE-051]My Awful Boss Is One Of Those Guys Who Can Fuck Forever Without Blowing His Load... Maron Natsuki

  • marin natsuki censoredcreampiesingle workDFEwaap entertainmentham the mcfearlessDFE-051DFE0512dfe00051
    • 2021-01-23
    346 min

    [EIKI-098]Why Is My Wife Doing This... This Super Charming Big Tits Wife Who Supposedly Loves Her Husband Is In The Midst Of Committing NTR And Going Cum Crazy For Illicit Sex 10 Big Tits Wives All Getting Creampie Fucked

  • aika sound of hoshino censoredbig titsmarried womanEIKIbig mocaleikiEIKI-098EIKI09857eiki00098
    • 2021-01-29
    51 min

    [fan-101]れい

  • amateur censoredbig titsamateurfanfan-101fan101fan-101
    • 2021-01-30
    42 min

    FC2PPV 1665655 Loli face shaved girl who is about to graduate from super cute makes her panties bite and pussy kissing ~ In addition, masturbation with electric massage machine immediately!

  • amateur uncensoredfc2
    • 2021-02-13
    54 min

    C0930 ki210214 Mutsumi Arita 27years old

  • amateur uncensoredc0930
    • 2021-02-22
    98 min

    [QRDF-008]SM Queen Road VOL.43 - Yuria

  • censoredanalQRDFqueen roadQRDF-008QRDF008qrdf00008
    • 2021-02-22
    73 min

    [SLRO-006]A Hostess I Met In Nagasaki Puts On A Show Barely Dressed! Himeka Saotome

  • amateur censoredbig titsbeautiful girlSLROcraneSLRO-006SLRO006
    • 2021-03-11
    53 min

    435MFC-088 [Teenage God Amateur] 3rd round with a female college student who is Ubu but has strong libido and the highest sensitivity ♪ All-you-can-eat all-you-can-eat nurses in erotic cami! Conceived festival of all vaginal cum shot! !! [Shiroto Gon

  • amateur censoredcreampieamateurmfcmfc-088mfc088435mfc-088
    • 2021-03-18
    120 min

    [SSIS-022]S*********ls Sell Their Bodies To Older Men For Extra Money Aqua Yamazaki

  • mizuyama yamazaki yukina shida censoreduniformbeautiful girlSSISs1 no 1 stylekc takedaSSIS-022SSIS022ssis00022
    • 2021-03-18
    169 min

    [SSIS-020]Mahina Amane In PLATINUM SOAP

  • amane mahina censoredbig titssingle workSSISs1 no 1 stylegoemonSSIS-020SSIS020ssis00020
    • 2021-03-21
    116 min

    [NNPJ-435]We Seduced This Beautiful Half-Japanese Babe Who Lives Overseas On Social Media And Convinced Her To Make Her Adult Video Debut

  • censoredamateurblowjobNNPJnanpa japanNNPJ-435NNPJ435nnpj00435
    • 2021-03-21
    162 min

    [HND-960]Banned From Her Signature Move! She Has To Forget She's A Porn Star And Seduce Men Like An Ordinary Girl For Passionate Creampie Sex Akari Mitani

  • mitani akari censoredcreampiesingle workHNDhon nakanao masakiHND-960HND960hnd00960
    • 2021-03-25
    77 min

    401SRHO-039 Riho (20)

  • amateur censoredcreampiebig titssrhosrho-039srho039401srho-039
    • 2021-04-14
    224 min

    [HUNTA-991]There's Only One Guy Working At My Lingerie Company - Me! Every Day I'm Surrounded By Girls With Fine Tits And Godly Asses! You Won't Believe What Else I Feast My Eyes On At The Office, Either...

  • censoredcreampielingerieHUNTAhuntercognac kaminohhh groupHUNTA-991HUNTA991hunta00991
    • 2021-04-22
    34 min

    Pacopacomama 042221_463 The Spring Show : Standing Urination Special Rina Suzuki

  • amateur uncensoredpacopacomama
    • 2021-05-01
    120 min

    [BBAN-325]Dream Fulfilled! I Want To Experience Pleasure Like No Other By Being Disciplined By My Beloved Eri Akira Wakana Shiroyama Eri Akira

  • shiroyama wakana aki erie arai erie yuka osawa censoredsquirtinglesbianBBANbibianBBAN-325BBAN325bban00325
    • 2021-05-20
    57 min

    FCP-018 [Delivery only] New "Cho, wait, eh! In a place like this !？" 1 beautiful 3 people

  • amateur censoredamateurbeautiful girlfcpfcp-018fcp018fcp-018
    • 2021-06-05
    120 min

    [ANB-189]I Became My Mother-in-law's Sex Toy: Thick Fucking With A Hot Mother-in-law! Yuri Tadokoro

  • yuri tadokoro censoredmature womanslutANBrubysusumu yanokuchinobleANB-189ANB189anb00189
    • 2021-07-09
    49 min

    521MGFX-012 Excavation ☆ Big Breasts Amateur 10

  • amateur censoredbig titsamateurmgfxmgfx-012mgfx012521mgfx-012
    • 2021-07-10
    127 min

    [KYMI-013]Pin-Up Slut

  • hamazaki mao suzuki mayu censoredslutKYMImiluaida yumenoKYMI-013KYMI013kymi00013
    • 2021-07-14
    62 min

    478LOLI-038 Chisa

  • amateur censoredcreampieschoolgirlloliloli-038loli038loli-038
    • 2021-08-12
    110 min

    [FGAN-046]My Very Own Panty Shot Doll Luna - Luna Tsukino

  • tsukino luna censoredcosplaysingle workFGANfechi mefetish eyesFGAN-046FGAN046h-1440fgan00046
    • 2021-08-17
    54 min

    230OREC-860 Shiro usa-Chan

  • amateur censoredcreampieamateurorecorec-860orec860230orec-860
    • 2021-08-26
    195 min

    [NHDTB-567]Girls" Lesbian Pleasure Points Massage Parlor 2. Fondling And Nipple Play For An Innocent Body That Can Barely Take The Endless Orgasms

  • censoredlesbianNHDTBnatural highsakurai baniraNHDTB-567NHDTB5671nhdtb00567
    • 2021-09-06
    124 min

    FC2PPV 2163461 "Hatsumi Saki" Uncensored Raw Vaginal Cum Shot Video Leaked! 5/2 Hours From Your Point Of View! Muramura Max’S Geki Kawa Sakipo-Chan

  • amateur uncensoredfc2
    • 2021-09-18
    86 min

    FC2PPV 2217618 Crying! !! Tears. "Genuine Amateur" "Genuine Tears" Foreign-Affiliated Cosmetics Salesperson, "Tears Porori" Lori Beautiful Amateur Beauty S ○ X Begins To Cry, And Even If She Is Crying, She Cums Inside The Bea

  • amateur uncensoredfc2
    • 2021-10-08
    230 min

    [HUNTB-114]"I Love Big Bouncies!" Shota-kun"s Lewd Prank - Mina Kitano

  • censoredcreampieHUNTBhunterkonnyaku kannohhh groupHUNTB-114HUNTB114huntb00114
    • 2021-10-17
    61 min

    HEYZO 2644 Masochistic Pampered Girl Gets Fucked And Creampie! – Akari Kato

  • akari kato uncensoredcreampiehandjobheyzo



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download