censored jav high vision nurse planning




FC2HMNPREDSHKDNNPJABWMIDVAVSANACRSQTEMARASTARSSANPPPDDTTWANZNGODGMEMADNAUKGMILK

2020-10-18
300 min

[LZBS-064]Boobquake! Wild Hip-Humping Cowgirl Best Selections 5 Hours - See Sensitive Pussies Twitching Through Limitless Orgasms!

  • hasumi claire yano tsubasa censoredbig titslesbianLZBSlesrebest lesbian playLZBS-064LZBS064lzbs00064
    • 2020-10-21
    54 min

    [tkwa-126]ゆうり 2

  • amateur censoredcreampieuniformtkwatkwa-126tkwa126tkwa-126
    • 2020-10-23
    241 min

    [MDBK-136]BAZOOKA Premium Legend Kurea Hasumi 4 Hours BEST

  • hasumi claire censoredcreampiebig titsMDBKk m producek taroubazookaMDBK-136MDBK136h-1496mdbk00136
    • 2020-10-23
    65 min

    SIRO-4304 [First shot] [Bell-shaped rampage milk] [Hentai female teacher] The back face of an active elementary school teacher. She was saying for her husband, but she made her beautiful breasts rampage as she wanted … Application amateur, first

  • amateuramateur censoredbig titsmarried womansirosiro-4304siro4304siro-4304
    • 2020-10-24
    241 min

    [SGSR-267]Nonfiction - Real Peeping Voyeur Footage Of Private Sexual Encounters Leaked Online 15 Girls Complete Edition

  • censoredbig titsSGSRbig morkaleigyochuushinsengumiSGSR-267SGSR26757sgsr00267
    • 2020-11-01
    297 min

    [DMOW-213]Footjobs For Masochistic Men Complete Works: 5 Hours

  • mizuno chaoyang blue censoredslutDMOWoffice k smowDMOW-213DMOW21336dmow00213
    • 2020-11-06
    62 min

    328HMDN-309 [Oni cock x married woman] Personal shooting 37 years old A married woman who is quickly watered with a thick cock! Cheating mom who is addicted to the joy of being seeded after being squid until the tide blows

  • amateur censoredcreampiemarried womanhmdnhmdn-309hmdn309328hmdn-309
    • 2020-11-12
    129 min

    [MEKO-194]Married Woman Who Took A High Paying Part Time Job As A Nude Art Model Fucked And Filled With Cum 29

  • censoredcreampieamateurMEKOmilf laboMEKO-194MEKO194h-1160meko00194
    • 2020-12-04
    96 min

    [sqb-078]さくら

  • amateur censoredbig titsamateursqbsqb-078sqb078sqb-078
    • 2020-12-17
    63 min

    10musume 121720_01 Amateur AV Interview: I need money because my husband has had a car accident Hitomi Yoshimura

  • amateur uncensored10musume
    • 2020-12-21
    130 min

    [CESD-959]A Beautiful 170cm-Tall Girl Is Twitching And Trembling With Pleasure As She Cums For Real Amu Hanamiya

  • hanamiya amu censoredmature womansingle workCESDceleb no tomoCESD-959CESD959cesd00959
    • 2021-01-04
    158 min

    [C-2608]Housewives' Adultery Trips #194

  • censoredCgo go zutakahashi kouichigogos coreC-2608C2608140c02608
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-21
    60 min

    435MFC-074 [Gonzo] miu / 23 years old / Trendy Imadoki girls and raw SEX!

  • amateur censoredcreampiebig titsmfcmfc-074mfc074435mfc-074
    • 2021-02-06
    121 min

    [SSNI-983]This Fresh Face Manager Will Usually Manage The Team With A Smile On Her Face, But The Truth Is She Cannot Physically Handle Being Around The Big Dick Team Members, But After The Game, They Were Pumped Up And Full Of Adrenaline, And So... L

  • kodama rena censoredsquirtingsingle workSSNIs1 no 1 stylesuisei akaiSSNI-983SSNI983ssni00983
    • 2021-02-12
    162 min

    [MIDE-884]Abstinence Sensitive Pussy: Convulsions, Screaming Acme Squirting From Hard Piston Fuck - Mia Nanasawa

  • nanasawa mia censoredsquirtingbeautiful girlMIDEmoodyzzaku araimoodyz divaMIDE-884MIDE884mide00884
    • 2021-02-14
    59 min

    FC2PPV 1686390 [Unprecedented 6P outflow! ] Big areola for big breasts and beautiful breasts! Bitch 3 beauty vs big cock corps creampie! Squirting! Continuous Acme Shuike Meat Forest Hyper Raw Saddle Orgy [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-02-20
    62 min

    C0930 ki210220 gold pack 20years old

  • amateur uncensoredc0930
    • 2021-02-20
    31 min

    FC2PPV 1695074 For a limited time [Individual] A wife who shakes her body and makes a strong face and screams and is forced to vaginal cum shot

  • amateur uncensoredfc2
    • 2021-02-20
    120 min

    [C-2618]My Wife's Friend Came Over And Slept In My Room Yorie-san (Not Her Real Name) Occupation: Married Woman Age: 45 Years Old And Naturally, I Helped Myself To Her Pussy

  • censoredmature womanCgogoskoichi takahashicore gogo sC-2618C2618
    • 2021-03-12
    84 min

    [ETQR-204](Daydream POV) Sex For Money WIth A Runaway Girl Suzu-chan

  • censoredcreampieuniformETQRerotic timeETQR-204ETQR204h-1186etqr00204
    • 2021-03-18
    262 min

    [AKDL-095]I Met An Amateur On Thursday 2 (Facial + Dental Assistant + Big Tits + POV + Married Woman + Masochistic Girl)

  • censoredamateurAKDLaquinoriaquinoriaknrAKDL-095AKDL0951akdl00095
    • 2021-03-19
    115 min

    HEYZO 2506 Loli Wife Got Enemas & Double Penetration -Mr. and Mrs. Ogoshi- – ogoshipearents

  • ogoshipearents uncensoredheyzo
    • 2021-04-16
    242 min

    [MXSPS-663]REQUEST Beautiful Sensitive Girls Nonoka Sakino

  • sakino flower censoredbeautiful girlMXSPSmaxingMXSPS-663MXSPS663h-068mxsps00663
    • 2021-04-21
    15 min

    10musume 042121_01 Please Watch Me Masturbating and Get Hard Mako Ashida

  • amateur uncensored10musume
    • 2021-04-23
    123 min

    [ISRD-001]Secretary In... (The Coercion Suite) Yumi Saeki ka

  • yuka saeki censoreddeepthroatbdsmISRDdream tickettakuanvividISRD-001ISRD00124isrd00001
    • 2021-04-24
    78 min

    355OPCYN-165 Hinami

  • amateur censoredbig titsmarried womanopcynopcyn-165opcyn165355opcyn-165
    • 2021-05-07
    244 min

    [HODV-21576]Mami Nagase Best

  • asami nagase censoredcreampiebig titsHODVh m pHODV-21576HODV215765642hodv21576
    • 2021-05-18
    62 min

    SIRO-4469 [First shot] [Fair-skinned beautiful breasts JD] [Climax of the abyss] Neat and clean beautiful breasts JD that is weak against pushing. Exploding her sullen propensity and shaking her natural breasts, she goes into a deep and deep orgasm v

  • amateur censoredamateursirosiro-4469siro4469siro-4469
    • 2021-06-01
    39 min

    Caribbeancom 060121-001 Popular Japanese Porn Actor Will Tell You : How to Make Love in The Right Way Nao Kojima

  • nao kojima uncensoredcreampiehandjobcaribbeancom
    • 2021-06-02
    113 min

    300MIUM-710 [International problems inevitable？ 8 J-Porn Unreasonable Attacks on Head-Body Russian Beauty] You can do whatever you want by turning around the blonde blue-eyed Eastern European beauty from morning till night even at work!

  • amateur censoredbig titsamateurmiummium-710mium710300mium-710
    • 2021-06-04
    165 min

    [ATID-464]Dancer Gets Her Asshole Fucked Miu Oka

  • miwa sakura censoredanalsingle workATIDattackersusubashisuiin madATID-464ATID464atid00464
    • 2021-06-11
    120 min

    [EBOD-830]24 Hours Cooped Up With A Hot Young Shut-In Nerd Girl With Huge Tits For Aphrodisiac-Addled Creampie Sex Nemu Kisaki

  • kisaki nemu censoredbig titssquirtingEBODe bodymichiru arashiyamaEBOD-830EBOD830ebod00830
    • 2021-06-11
    140 min

    [EBOD-829]My Girlfriend's Big Tits - I Couldn't Resist The Temptation Of Whispered Dirty Talk From A Knock-Out Babe And Ended Up Giving Her My Creampie. Mina Kitano

  • mina kitano censoredcreampiebig titsEBODe bodyrokusaburo mishimaEBOD-829EBOD829ebod00829
    • 2021-06-15
    135 min

    [SDJS-119]As A Reward For Working So Hard This Past Year, We Decided To Reward Her With Some Company Benefits, And Gave Her A Coupon For A Super High Class Massage Parlor! This SOD Employee Is In Her Second Year At The Company, And Now She's Hook

  • kotoba nakayama censoredsingle workSDJSsod createchinpo dazaisod starSDJS-119SDJS1191sdjs00119
    • 2021-06-25
    49 min

    Caribbeancom 062521-001 Lolicon Soapland 12 Emi Aoi

  • emi aoi uncensoredcreampiehandjobcaribbeancom
    • 2021-07-03
    242 min

    [VEC-483]My Mom's Friend: Highlights 4 - 4 Hours

  • censoredcreampiemature womanVECvenusmegami venusVEC-483VEC483vec00483
    • 2021-07-09
    147 min

    [IPX-693]If You Don't Want to Be Caught, Take Off Your Clothes. Shopping Lifting Beauty...You Can't Go Home. Insistant Tragedy. Minato-kun Women's Edition Yume Nishimiya

  • yume nishinomiya censoredcreampiedeepthroatIPXidea pocketkyouseitissueIPX-693IPX693ipx00693
    • 2021-07-09
    118 min

    [MEYD-686]A man's screams echo out from a private beauty clinic opened by a neighborhood housewife. I was nervous about making a reservation, but this nympo goddess' full course made me cum continuously to the point of fainting. Sakura Misaki

  • cape sakura censoredsluthandjobMEYDtameike gororyo inugamiMEYD-686MEYD686meyd00686
    • 2021-07-30
    119 min

    [JBD-272]Unbanned For The First Time: The Bondage Of Shame Enema Riho Fujimori

  • riho fujimori censoredbdsmsingle workJBDattackerskanou hanahebi bakuJBD-272JBD272jbd00272
    • 2021-08-12
    158 min

    [SPRD-1445]My Sex Friend From That Time Is... My Friend"s Mother - Kana Morisawa

  • kana morisawa kanako iioka censoredmature womansingle workSPRDtakara eizouohare konaleddinSPRD-1445SPRD144518sprd01445
    • 2021-09-18
    115 min

    [BIJN-207]The Document. Instinct To Show Off Fully For Climaxing Sex. Pleasure Seeking Married Woman Breaks Boundaries For Quick Pounding Creampie Orgy. Yuri Sasahara

  • yuri sasahara censoredcreampiesingle workBIJNbijin majoBIJN-207BIJN207bijn00207
    • 2021-10-01
    157 min

    [CAWD-296]"I Love Old Men!" Former S*****t Council President"s Sex Preferences Revealed! Idol-class Beauty Loves Middle-aged Men Makes AV Debut! Koharu Hanasaki

  • koharu hanasaki censoredsquirtinguniformCAWDkawaiiCAWD-296CAWD296cawd00296
    • 2021-10-19
    35 min

    275OCHA-097 Tin

  • amateur censoredcreampieschoolgirlochaocha-097ocha097275ocha-097
    • 2021-10-20
    48 min

    FC2PPV 2360859 Baseball Club Girls Who Became A Hot Topic In N ● K Manet’s No Hand Deep Throat Blow Cum 5 Barrage Swallow Girls ＃ 3

  • amateur uncensoredfc2
    • 2021-11-12
    154 min

    [PPPD-977]I Hate My Pervert Boss But I Love His Huge D*ck... I Lose My Senses After He Grabs My Breasts, And I Come Back For Creampie Sex Seconds... Kie Arisu

  • kisaki alice censoredcreampiebig titsPPPDoppaiPPPD-977PPPD977pppd00977
    • 2021-11-13
    114 min

    [BBTU-024]Right on the Tits! Ahegao Big Tits Gets a Sperm Bukkake, Nene Tanaka

  • nene tanaka censoredbig titscosplayBBTUdogmatenunore no boinBBTU-024BBTU024bbtu00024
    • 2021-11-19
    141 min

    [DASD-938]Married Woman Cheating With A Black Guy - Secretary Gets Wet For Her Black Boss. Fucked Hard With His Huge Rod. Arisu Nanase

  • alice nanase censoredcreampiesingle workDASDdasmishima rokusaburoDASD-938DASD938dasd00938



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download