censored jav high vision immediately saddle




FC2SQTEHNDWAAADTTCHRVCAWDMEYDSANHDKAJULMIAAKBINATRCESDSSISATIDWANZAUKSBLKMIDE

2020-09-11
192 min

[MKMP-353]Beautiful Hotel Worker Has Wild Sex With A Customer Staying Overnight In A Secret Room And Repeatedly Has Continuous Ejaculations Until Morning Yuria Satomi

  • satomi yuria censoredblowjobslutMKMPkm producemillionMKMP-353MKMP35384mkmp00353
    • 2020-09-24
    17 min

    10musume 092420_01 Secret Pussy Collection: Sumire Kamogawa

  • amateur uncensored10musume
    • 2020-10-03
    189 min

    [HUNTA-862]My Neighbor Is A Horny Young Wife Who Is Hunting For Cocks, And I Fell For Her Trap And Her Lures Of Temptation, And Now She's Fucking My Brains Out! And Now That This Young Wife Is Massively Detonating All Of The Pent-Up Lust She'

  • censoredcreampieHUNTAhunterkoichi davidsonhhh groupHUNTA-862HUNTA862hunta00862
    • 2020-10-11
    116 min

    [BAHP-052]AV Footage Tricking The Kinda Girls Who You'd Like To Fuck! Rika Yamamoto Continually Climaxes, Overwhelming Her Sensitive Body

  • yamamoto renka censoredblowjobsingle workBAHPbaltanminimal iwamurahoppinBAHP-052BAHP052bahp00052
    • 2020-10-11
    108 min

    [HERY-106]A Man's Daughter Turned Into A Complete Bitch Collection 4 - Sakuya Yuki

  • sakiya yuki censoredcreampiesingle workHERYyellow mousouzokudr fuyellowHERY-106HERY106hery00106
    • 2020-10-30
    42 min

    FC2PPV 1552173 [Personal shooting] Cuckold a frustrated friend’s wife! A fair-skinned plump body is raped by another stick and agonizes herself! [Appearance / Creampie]

  • amateur uncensoredfc2
    • 2020-11-07
    52 min

    210AKO-406 AOI

  • amateur censoreduniformschoolgirlakoako-406ako406210ako-406
    • 2020-11-13
    180 min

    [SQIS-036]Fallen Into Pleasure Hell

  • censoredmarried womandramaSQISfa proSQIS-036SQIS036sqis00036
    • 2020-11-16
    79 min

    259LUXU-1331 Luxury TV 1327 Former race queen beautiful mature woman with a lustrous glamorous body makes her first AV appearance! Sprinkle the sex appeal that can not be hidden, and the storm of cum on intense sex after a long absence! Shake big tit

  • amateur censoredbig titsamateurluxuluxu-1331luxu1331259luxu-1331
    • 2020-11-25
    52 min

    FC2PPV 1583313 [Complete appearance → Really dangerous if it gets caught] 3P continuous vaginal cum shot! B ○ series underground idol ❤ Mini sailor & glossy knee high ❤ Saddle tide busher! Sucking two cocks! Vaginal Iki Convulsions Acme 2 Barrage

  • amateur uncensoredfc2
    • 2020-11-28
    118 min

    [MIDE-855]She Was Fucked... This Beautiful Office Lady Came To Me For Help, And She Was Dripping Wet And Not Wearing A Bra And I Just Couldn't Resist, So I Fucked Her. Minami Hatsukawa

  • hatsukawa minami censoredcreampiesingle workMIDEmoodyzlamb chopmoodyz divaMIDE-855MIDE855mide00855
    • 2020-12-04
    115 min

    [PARATHD-3052]Girls Want To Play Pranks Too! Time-Stopping Spell To Tease Hard Cocks

  • censoredPARATHDparadise tvPARATHD-3052PARATHD3052parathd03052
    • 2020-12-27
    254 min

    [SIGL-001]Amateur Girls Vol. 1: 3 Horny Amateur Girls Getting Raw Creampies

  • censoredcreampiebig titsSIGLshirotogaru mousouzokushiroto guardsSIGL-001SIGL001sigl00001
    • 2020-12-31
    136 min

    [JUL-429]I Want To Be Madam's Bike Saddle - Old Man Saddle Thief Goes After Married Woman With Nice Ass - Nao Shinguji

  • jinguji temple nao censoredmature womansingle workJULmadonnamametaro mamezawaJUL-429JUL429jul00429
    • 2020-12-31
    229 min

    [HUNTA-920]Doesn't She Know She's Flashing Me？! The Young Wife Who Works At The Supermarket Part-Time With Me Keeps Bending Over In Short Skirts, And Picking Things Up Off The Ground So I Can See Her Panties...

  • censoredcreampieHUNTAhunterkoichi davidsonhhh groupHUNTA-920HUNTA920hunta00920
    • 2021-01-06
    62 min

    [ion-071]葉子(21)

  • amateur censoredamateurionion-071ion071ion-071
    • 2021-01-07
    88 min

    SRT-021 Yui

  • amateur censoredcreampiebig titssrtsrt-021srt021srt-021
    • 2021-01-23
    149 min

    [HND-943]This Pay-For-Play Gal Is Usually A Cold Fish During Sex, But When She Won The Lottery She Immediately Changed Her Tune! This Slut Kept On Begging For Creampie Sex While Earning Tips. Hina Nanami

  • hina nanami hina nanase censoredcreampieblowjobHNDhon nakausa pyonHND-943HND943hnd00943
    • 2021-01-28
    60 min

    H0930 ki210128 Saeko Hamaoka 28years old

  • amateur uncensoredh0930
    • 2021-02-02
    66 min

    FC2PPV 1669624 [First time limited 1980] Beautiful big breasts natural G cup ❤️ Fair-skinned Echiechi body ❤️ Pile driving piston ❤️ Massive vaginal cum shot in a very narrow pussy ❤️ * Review privilege “Semen exploitation with intense handjob w

  • amateur uncensoredfc2
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-11
    240 min

    [NHDTB-490]Toilet Pranks After Getting Her Pussy Nice And Wet With Experienced Techniques, We Took This Maso Barely Legal Babe To A Hotel And She Obediently Agreed To A POV Filming Session

  • censoredschoolgirlNHDTBnatural highvanilla sakuraiNHDTB-490NHDTB4901nhdtb00490
    • 2021-02-13
    73 min

    383REIW-045 Aoki-san

  • amateur censoredcreampiebig titsreiwreiw-045reiw045383reiw-045
    • 2021-02-18
    118 min

    [SSNI-993]Porn Star Mako Iga Makes Her Totally Nude Debut To Celebrate Her 2nd Anniversary! No Script, No Direction, Not Just A Fantasy! Pleading For Cunnilingus! Ecstatic Siren t Climaxes! French Kiss Pov Footage! The Most Nut-Busting, Naughty, Priv

  • iga mako censoredsingle workSSNIs1 no 1 styletiger kosakaiSSNI-993SSNI993ssni00993
    • 2021-02-19
    98 min

    [VENX-010]My Stepmom Just Started Working At A Soapland Brothel So She Made Me Her Practice Partner Ayano Fuji

  • ayano kato censoredcreampiemature womanVENXvenusmajime kitanofakecest winntersVENX-010VENX010venx00010
    • 2021-02-25
    93 min

    [OKP-078]Momoko, An Office Lady With Godly Glasses: Get A Taste Of Her, In Her OL Suit, Wearing Her Glasses, Showing Off Her Beautiful Legs Wrapped In Raw Pantyhose, And Lick Her Feet From Her Soles To Her Toes! She Lets You Do Whatever You Want, Wit

  • shoko ueki censoredsingle workbukkakeOKPdaddy s private photosgoro koenjigodly pantyhoseOKP-078OKP0781okp00078
    • 2021-03-10
    36 min

    FC2PPV 1720760 Up to 17 1480 [No] Fair-skinned tall beautiful girl. She makes vaginal cum shot in an undesired act.

  • amateur uncensoredfc2
    • 2021-03-11
    122 min

    [GS-379]My Female Coworker Explodes With Lust At The Company Party! We Had A Work Party To Let Everyone Unwind After Working From Home For So Long

  • censoredGSsosoru garconspader ikebukuroGS-379GS3791gs00379
    • 2021-03-11
    120 min

    [FSDSS-186]Multiple Ejaculation Recipocrated Love Sex At The Soapland Staring Into Each Other's Eyes Yume Nikaido

  • nikaido yume censoredbig titsbeautiful girlFSDSSfalenoflagmanfaleno starFSDSS-186FSDSS1861fsdss00186
    • 2021-03-13
    148 min

    [DASD-823]Perverts Attract Other Perverts. An Excessively Embarrassing Cum Bucket NH University S*****t Yura Amatsuka

  • angel yura censoredsingle workdramaDASDdasrokusaburo mishimaDASD-823DASD823dasd00823
    • 2021-03-13
    150 min

    [APKH-165]I Discovered This Quiet And Unassuming Girl In Glasses At The Library, But It Turns Out That She's A Super Big Tits Horny Bitch, And She Sucked All Of My Semen ... Nenne Ui

  • first love censoredcreampiebig titsAPKHaurora project annexhaurora project anexAPKH-165APKH165apkh00165
    • 2021-03-18
    477 min

    [OFJE-304]Gorgeous Big Tits Bouncing All Over The Place! All G-Cup And Bigger Actresses Ride Dick Until They Cum 50 Rounds

  • arisu aka jun jun censoredbig titsbeautiful girlOFJEs1 no 1 styleOFJE-304OFJE304ofje00304
    • 2021-03-21
    118 min

    [JUL-506]Madonna "Exclusive Transfer" First Edition! I Always Have Raw Sex With My Father In Law After S******g With My Husband While I'm Ovulating... Minori Hatsune

  • hatsune minori censoredbig titsmature womanJULmadonnashiro shotenJUL-506JUL506jul00506
    • 2021-03-21
    119 min

    [JUL-518]My Loving Stepmother Who Raised Me With Her Own Hands Is Seduced By My Awful Friend... Hijiri Maihara

  • kiyoshi maihara censoredcreampiemature womanJULmadonnashiro shotenJUL-518JUL518jul00518
    • 2021-04-02
    249 min

    [YMDD-228]The Slut Wagon Is Here! Bursting With Sexy Surprises! Let's Enjoy Sex - June Lovejoy And Rizu's Exciting Road Trip! Big With 500 More Big Banging Booty! Sensual, Fuckable, Voluptuous White Girl Bodies Cram Every Corner Of Your Scree

  • june lovejoy censoredcreampiehandjobYMDDmomotaro video publishingsuzuki rizuyoung peachYMDD-228YMDD228ymdd00228
    • 2021-04-21
    77 min

    492JCHA-008 Gonzo Of 40 Years Old Single Unemployed Man

  • amateur censoredamateurbeautiful girljchajcha-008jcha008492jcha-008
    • 2021-05-01
    153 min

    [OBA-414]My New Step Son Is A Total Hottie... Nozomi Haneda

  • nozomi haneda censoredmature womanslutOBAmadonnabieber gonzoobasanOBA-414OBA414oba00414
    • 2021-05-01
    150 min

    [SSIS-061]Pleasure! Sexy Model Fucks 3 Times Kaoru Yasui

  • kaoru yasui censoredbig titssquirtingSSISs1 no 1 stylemon cSSIS-061SSIS061ssis00061
    • 2021-05-26
    121 min

    512EMST-003 kokojapan

  • amateur censoredcreampieuniformemstemst-003emst003512emst-003
    • 2021-05-28
    80 min

    FC2PPV 1841460 An overwhelming angel who has landed on the ground. He was 18 years old just after graduation when he was an idol. She is an innocent girl who is healed only by her voice. She couldn’t stand it 3 minutes after insertion and made a

  • amateur uncensoredfc2
    • 2021-06-11
    119 min

    [MEYD-680]I Caught The Haughty Married Woman Next Door Working At A Brothel And Blackmailed Her Into Taking My Creampie! Now She's My Obedient Sex Pet Outside Of Work, Too Riona Hirose

  • rio hirose censoredcreampiesingle workMEYDtameike goroshiro shotenMEYD-680MEYD680meyd00680
    • 2021-07-06
    82 min

    493NAEN-078 Yen! ？？ Systemic genitals! ？？ Super Sensitive Bitch Girls ○ Ryoka Kurumi Commits Raw High Speed Piston All Night

  • amateur censoredamateurbeautiful girlnaennaen-078naen078493naen-078
    • 2021-07-15
    105 min

    [BBTU-016]Boobie Gal Bitch Shuri Hazuki

  • hazuki shuri censoredbig titssingle workBBTUdogmatenunmy big titsBBTU-016BBTU016bbtu00016
    • 2021-07-22
    157 min

    [WAAA-084]"I'm Already Cumming!" I Yelled Out as I Fucked the Slutty Girl I'm Tutoring and Came Inside Her. Kasumi Tsukino

  • kasumi tsukino censoredcreampiebig titsWAAAwanz factorywanzWAAA-084WAAA084waaa00084
    • 2021-07-23
    144 min

    [MMKZ-100]Big Plump And Busty Ass - Hana Himesaki

  • himesaki hana censoredbig titssingle workMMKZmarrionkojiro miyamotoirisMMKZ-100MMKZ100mmkz00100
    • 2021-07-30
    31 min

    FC2PPV 1946644 First Shot! !! Limited Number! Creampie In A Fascinating Fcup Beauty Busty Body! !! I Didn’T Think It Was So Good … (Blowjob Scene Appearance)

  • amateur uncensoredfc2
    • 2021-08-06
    149 min

    [HODV-21596]I Filmed An AV! A Convenient Devilish Little Slut With G-cup Breasts - Yuka Hoshi

  • yuka hoshi censoredcreampiebig titsHODVh m pHODV-21596HODV215965642hodv21596
    • 2021-08-07
    91 min

    [ANX-136]A Strong Addiction To Being Not Quite Yourself: Her Territory - A New Area. Maina Yuuri.

  • yuuri censoredbig titscosplayANXsaimin kenkyuusho bekkansainansaimin rei onna saimin kenkyuusho bekkanANX-136ANX136anx00136



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download