censored jav big tits high vision tall




FC2ROYDBLKSPRDDASDCHRVJUFEMIDVGVHMARAAVSAMVSDGMEMPPPDSTARSAWDFSDSSSDABNGODKBISAN

2021-01-11
103 min

FC2PPV 1636711 [Idol / Student] Gonzo video with Saffle underground idol Y-chan will be released w Fair-skinned fluffy marshmallow body shakes violently with a demon egg piston !! Impact video [Personal shooting / amateur]

  • amateur uncensoredfc2
    • 2021-01-13
    102 min

    FC2PPV 1642356 [Individual shooting] A classmate of the metropolitan commercial department, a beautiful girl who needs money. [4K image quality]

  • amateur uncensoredfc2
    • 2021-01-16
    165 min

    [DVDMS-623]This Office Lady Was Wearing Hot Business Suits Over Her Tight Ass, And I Could No Longer Resist, So I Shoved My Big Dick In From Behind For A Quickie! 2 While Showing Some Real Estate Property To A Male Customer, He Seduced Her With High-

  • censoredamateurDVDMSdeep sswing nagaseDVDMS-623DVDMS623dvdms00623
    • 2021-01-17
    134 min

    [SORA-291]Infidelity Is Her Hobby - Faithless Wife Squirting For Adulterous Fucks - This Serial Cheater's Pussy Is Drenched. Adultery Trip With Her Fuck Buddy Right Under Her Husband's Nose. This Shocking Exhibitionist Cums 34 Times Before Sh

  • censoredSORAyama to sorahimu lockSORA-291SORA291sora00291
    • 2021-01-18
    68 min

    IDJS-024 Aika

  • amateur censoredcreampieamateuridjsidjs-024idjs024idjs-024
    • 2021-01-20
    240 min

    [MGDN-145]A Mature Auntie With A Ripe Body's Massage Shop, 240 Min.

  • rei higuchi yoshinori yoshino censoredmature womanMGDNstar paradisemegadonMGDN-145MGDN145h-254mgdn00145
    • 2021-01-27
    142 min

    [FONE-133]The Greatest, Rail-Thin (See Her Exposed Ribs), Skinny Lolita Babe In The History Of Adult Videos. She's A Slender And Svelte Beautiful Girl Whose Ribcage Is Her G-Spot, And She's A Secretly Horny Slut Who Has Fucked Over 1,000 Men.

  • censoredcreampieamateurFONEfirst starplus first starFONE-133FONE133h-491fone00133
    • 2021-01-28
    61 min

    H4610 ki210128 Yuina Kitami 19years old

  • amateur uncensoredh4610
    • 2021-02-01
    245 min

    [JMD-144]Baby-Making Mama: Tricking A Plump Madam With Colossal Tits Hidden Under Her Clothes Into A Creampie Through A Match-Making App

  • shizuka omori amami bookmark censoredcreampiebig titsJMDmomotaro eizoasakusa ga jirou manJMD-144JMD144jmd00144
    • 2021-02-02
    42 min

    FC2PPV 1657568 [Personal shooting] Tomohame! I took a gonzo like a friend ☆ Rikako 28 years old ☆

  • amateur uncensoredfc2
    • 2021-02-18
    118 min

    [SSNI-998]From That Moment When My Daughter's Friend Kissed Me... Mai Shiomi

  • mai shiomi censoreduniformblowjobSSNIs1 no 1 stylejo asagiriSSNI-998SSNI998ssni00998
    • 2021-02-28
    121 min

    [RD-1043]Filthy Showa Sex Drama Step Son Accosts His Step Mom While Watching Her Piss... Teaching A Lesson To The Sixty Something Wife Next Door For Stealing Figs

  • mihara sumire yuriko aragaki censoredmarried womanblowjobRDathena videomurayamaathenaRD-1043RD1043149rd01043
    • 2021-03-26
    45 min

    359TYVM-141 Plump Glamor Young Wife Portio Cum Squirting Sex! !!

  • amateur censoredcreampiebig titstyvmtyvm-141tyvm141359tyvm-141
    • 2021-04-09
    420 min

    GWGANA-001 [Limited time sale] [MGS exclusive distribution BEST] Nampa TV Vol.01 Golden Selection 26 people 420 minutes

  • amateur censoredamateurgwganagwgana-001gwgana001gwgana-001
    • 2021-04-10
    127 min

    [APNS-236]I Was Just Sent The Video Of My Beloved Ex-Fiance Getting G*******ged On DVD... Rin Kira

  • kira rin censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-236APNS236apns00236
    • 2021-04-10
    45 min

    H4610 tk0032 Takako Iimi 20years old

  • amateur uncensoredh4610
    • 2021-04-21
    60 min

    FC2PPV 1780259 Relieve self-restraint and release stress for both men and women! Continuous vaginal cum shot!

  • amateur uncensoredfc2
    • 2021-04-26
    129 min

    300MIUM-698 Beautiful legs pants suit is erotic Asagaya OL GET! !! The sexual desire accumulated by BL writers who have experience of opening stores explodes tonight! !! The flow of vaginal cum shot → de S awakening is unpredictable and continuous! !

  • amateur censoredcreampiebig titsmiummium-698mium698300mium-698
    • 2021-04-27
    41 min

    Pacopacomama 042721_465 Cum On Tits Special: Natsuki Kikuta, Yuki Shinoda, Nanako Asahina

  • amateur uncensoredpacopacomama
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-30
    46 min

    FC2PPV 1794704 Testicle Massage ＃ 13 Aika Kirishima [Tokyo Hands @ Men’s Esthetics]

  • amateur uncensoredfc2
    • 2021-05-14
    17 min

    10musume 051421_01 Look at my familiar masturbation that is 4 days a week Manami Nishi

  • amateur uncensored10musume
    • 2021-05-21
    120 min

    [HZGD-188]

  • kato camellia censoredcreampiebig titsHZGDmarried woman flower garden theaterhirokoji osakiimage married woman flower garden theatHZGD-188HZGD188h-1100hzgd00188
    • 2021-06-02
    123 min

    [GVH-245]A Father In Law And Daughter In Law, Engaged In Hard And Tight Creampie Sex Kanna Misaki

  • kanna misaki censoredcreampiegrandfatherGVHglory questtsunemori takahashiGVH-245GVH24513gvh00245
    • 2021-06-10
    240 min

    [SW-779]I Went To A Coed Hot Spring Resort Filled With Nothing But Women, And I Was The Only Man There 15 Big Tits Mamas A 240-Minute Special Faced With All These Huge Tits, My Adolescent Cock Was Rock Hard And Ready To Roll, So I Squeezed It Hard, P

  • censoredbig titsmarried womanSWswitchyocchanswitch switchSW-779SW7791sw00779
    • 2021-06-13
    77 min

    200GANA-2500 Seriously Nampa, first shot. 1648 Even though it’s so cute! A sad beautiful girl who was afraid to make a boyfriend because of the shock that her ex-boyfriend had an affair with her friend! It’s usually quiet, but when it comes

  • amateur censoredamateurbeautiful girlganagana-2500gana2500200gana-2500
    • 2021-06-19
    120 min

    [OPUD-337]Enema, Pissing BUKKAKE: Breaking In A Masochistic Man - Hotaru Mori

  • hotaru mori censoredbig titsslutOPUDoperanario sakamotoOPUD-337OPUD337opud00337
    • 2021-06-19
    150 min

    [NNPJ-454]# Amateur Fan Film - This Busty F-Cup Showed Up To Model Swimsuits, But Little By Little Things Got Erotic, And Soon She Was Slipping Those Swimsuits Off To Take A Creampie - In Her Porn Debut. College Girl Riku

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-454NNPJ454nnpj00454
    • 2021-07-01
    126 min

    [AMBI-130]Step-siblings' Twisted Love: What Happened When My Younger Stepsister Got A Boyfriend - Yui Nagase

  • yui nagase censoredcreampieschoolgirlAMBIplanet plusdirector oanbibarentsuAMBI-130AMBI130h-237ambi00130
    • 2021-07-01
    60 min

    Pacopacomama 070121_497 Secret with the wife next door Reiko Shibata

  • amateur uncensoredpacopacomama
    • 2021-07-09
    170 min

    [EBOD-844]This nurse from Tohoku with a soothing smile and an ample J cup who kindly takes care of grandad as well as cocks makes her AV debut. Q: Why do girls with big boobs look so friendly？ A: Because big boobs make them look maternal. An Ayumi

  • ayumi an censoredbig titssingle workEBODe bodylamb chopEBOD-844EBOD844ebod00844
    • 2021-08-07
    200 min

    [BAZX-302](All POV) Nailing My Hot Receptionist vol. 004

  • censoredcreampieuniformBAZXk m producetodobazookaBAZX-302BAZX302bazx00302
    • 2021-08-13
    245 min

    [DVDMS-702]Ordinary Guys And Girls Caught On Camera - Shocking Hook-Ups After The Class Reunion! Will These Former Classmates Who Haven"t Seen Each Other For 10 Years Be Willing To Bang At A Love Hotel？! What About If We Offered Them One Grand Fo

  • censoredcreampiebig titsDVDMSdeepsiwanagadeep sDVDMS-702DVDMS702dvdms00702
    • 2021-08-25
    31 min

    FC2PPV 2071287 [First Shot] 18-Year-Old Active Female ◯ Student, Super Slender Beautiful Girl Rika-Chan!

  • amateur uncensoredfc2
    • 2021-09-02
    15 min

    FC2PPV 2130911 [Individual Shooting] Metropolitan Handicraft Club ② G Cup Long Black Hair And Glaring Sex Gonzo Unavoidably For 〇

  • amateur uncensoredfc2
    • 2021-09-17
    124 min

    [TPPN-205]Rurucha"s TEPPAN Premier! A Cum Soaked Daze With Plenty Of Squirting And Love Juice! Nonstop Group BUKKAKE

  • rurucha censoredsquirtingsingle workTPPNteppanTPPN-205TPPN205tppn00205
    • 2021-09-20
    58 min

    FC2PPV 2225432 [Individual Shooting] No79 Yui-Chan 18 Years Old Ss Class Beautiful Girl’S Real Virgin Graduation Ceremony

  • amateur uncensoredfc2
    • 2021-09-23
    123 min

    [FSDSS-284]Girl Who Loves To Play Pranks Took A Love Potion And Is Fucked And Made To Cum Forever!Minori Kawanami

  • real village henan censoredcreampiesingle workFSDSSfalenogr3faleno starFSDSS-284FSDSS2841fsdss00284
    • 2021-10-09
    135 min

    [CEAD-369]I am a Horny Masturbator Who is a Pleasure Fanatic, Vol. 22 Chisato Shoda

  • shota chisato censoredbig titsmature womanCEADserebu no tomoCEAD-369CEAD369cead00369
    • 2021-10-23
    243 min

    [MCSR-457]At My Favorite Bar... Lewd Sex Dirty Talk WIth Beautiful Hostess, and Sopping Wet Pussy 4 Hour-Special. Erotic Hostess 10 People!

  • censoredmature womanMCSRbigmorkalkamejima saburoumasukattoMCSR-457MCSR45757mcsr00457
    • 2021-10-28
    125 min

    [SPRD-1473]This World Is Made Of Men And Women, And Nothing Else An Old Man Who Likes To Lick, And A Horny Bride June Lovejoy

  • june lovejoy censoredmature womansingle workSPRDtakara eizoukuromatsu shigealeddinSPRD-1473SPRD147318sprd01473
    • 2021-11-13
    49 min

    H4610 ki211114 Madoka Kanbe 21years old

  • amateur uncensoredh4610
    • 2021-11-25
    49 min

    H0930 ki211125 Takako Kuronuma 38years old

  • amateur uncensoredh0930
    • 2021-12-03
    181 min

    [SHKD-981](Caution When Viewing) Trick Pick Up Ring. Ami Kitai

  • kiyo ami censoredbig titssingle workSHKDattackersshi yoru akuSHKD-981SHKD981shkd00981
    • 2021-12-07
    68 min

    494SIKA-130 Sex Rolled Up With Aphrodisiac And Alcohol

  • amateur censoredamateursikasika-130sika130494sika-130
    • 2021-12-17
    59 min

    230OREC-957 Momo (Shinhime Momo)

  • amateur censoredamateurcosplayorecorec-957orec957230orec-957
    • 2022-01-01
    106 min

    [SQTE-398]This Bitch Is Crazy!! A Beautiful Girl With Short Hair Is Enjoying Teary-Eyed Sex Nana Hayami

  • don t be quick censoredsquirtingblowjobSQTEs cuteSQTE-398SQTE398sqte00398
    • 2022-01-13
    135 min

    [IENF-187]Amateur Picking Up Girls. Finding A Naive S********l In Shinjuku That Gets A 18cm Huge Dick Between Her Thighs, And Then It Just Gets Even More Lewd From There.

  • satoshi kuruki horikita wan censoredcreampieschoolgirlIENFienergyienfIENF-187IENF1871ienf00187



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download