censored humiliation high vision deepthroat jav




FC2ATIDHODVJUFEFSDSSKBIIPXAUKGJULROYDSANAWDPPPDHDKAPREDSSNISHKDCAWDAMBIBLKMILK

2020-12-06
66 min

300NTK-480 Blow up the chastity idea of a beautiful G cup with an aphrodisiac! !! Complete reason collapse with trembling G milk piston SEX from swaying love! !! Succeeded in becoming a spear man who replaces a big rare cheating stick! !! Those who r

  • amateur censoredcreampiebig titsntkntk-480ntk480300ntk-480
    • 2020-12-17
    122 min

    [SSNI-940]Tsukasa Aoi 's All-Licking Sex - From Faces, Anal Holes, To The Tips Of Toes, Everything Gets Licked, Sucked, And Covered With Saliva Special

  • tsukasa aoi censoredbeautiful girlsingle workSSNIs1 no 1 stylemon cSSNI-940SSNI940ssni00940
    • 2020-12-25
    66 min

    FC2PPV 1619971 First shot ❤️ 173 cm badminton club! Rich SEX with a slender national music college student who has too few experienced people ☆ [Personal shooting]

  • amateur uncensoredfc2
    • 2020-12-26
    120 min

    [WAAA-026]Sex With You: Sharing A Room And Giving Sloppy Creampies, Large Orgies - Chitose Yura

  • chitose in the evening censoredcreampiebig titsWAAAwanz factorywanzWAAA-026WAAA026waaa00026
    • 2021-01-02
    55 min

    FC2PPV 1629807 041 [3P Special Oma ● Kotoo ○ Chi (PTM)] A blow semen beam from a big orgy with daughters of anything

  • amateur uncensoredfc2
    • 2021-01-10
    126 min

    [BAHP-067]The Strongest Pussy - Real Sex With A Different Dick Every Day - 340 Fucks A Year - Her Fuckbuddy Rotation - Yuno Kaname

  • yuno kaname censoredblowjobslutBAHPbaltandaibutsu yoshidahoppinBAHP-067BAHP067bahp00067
    • 2021-01-21
    123 min

    [GS-372]Serious Girl Gets Caught Shoplifting And Her Teacher Reprimands Her By Taking Her To Pleasure Paradise Making Her Cum Over And Over Again!

  • censoredschoolgirlGSsosoru x garcontumblerGS-372GS372h-101gs00372
    • 2021-01-23
    46 min

    450OSST-007 The sober girl I found in Korea was a wasteful beauty with hidden big breasts and a beautiful look hidden with glasses! The self-proclaimed C cup and the hidden big breasts that lie modestly are good to massage! It’s okay to shake!

  • amateur censoredbig titsamateurosstosst-007osst007450osst-007
    • 2021-01-24
    240 min

    [ARAN-014]A Beautiful Girl In A Climax Hell Pictorial A Live Sacrifice Upon The Cruel Execution Chamber Watch Her Drip With Bittersweet, Dangerously Smelling Honey See Her Bearded Clam Twitch And Throb With Spasmic Ecstasy INFERNO BABE ULTRA FILM

  • censoredbeautiful girlbdsmARANbabyentertainmentshiroto musume kyoso kyokuARAN-014ARAN014aran00014
    • 2021-01-24
    27 min

    FC2PPV 1657528 Until 27th 2480pt → 1980pt [Personal shooting] Beautiful office lady at the reception desk of the company ・ Because the repayment period has expired, four other sticks will receive interest in the car.

  • amateur uncensoredfc2
    • 2021-01-28
    72 min

    [SIIN-022]純真無垢 関谷セリナ

  • sekiya serina censoredbig titssingle workSIINsidSIIN-022SIIN022h-816siin00022
    • 2021-01-29
    242 min

    [NASH-442]Me And My Stepmom's Secret All 6 Stories

  • kozue tokita ayaka makimura censoredmature womanstepmomNASHpinknadeshikoNASH-442NASH442h-067nash00442
    • 2021-02-04
    142 min

    [AKDL-082][Amateur Audition] Keeping Her Porn Debut A Secret At Work - "Smooth Pussy, Pink Labia" - Slutty Sex Addict Who Craves It Everyday - Asuka, 24, Office Lady

  • censoredamateurAKDLaquinoriaquinoriaknrAKDL-082AKDL0821akdl00082
    • 2021-02-05
    51 min

    FC2PPV 1673368 Super Sensitive Shortcut Beautiful Slender Chippai Pan Pet Shop Clerk Life’s First Gonzo

  • amateur uncensoredfc2
    • 2021-02-15
    340 min

    [YPTS-002]Big Tits Cosplayer Creampie: Sucking Self-shoot

  • censoredcreampiebig titsYPTSpetersYPTS-002YPTS002h-021ypts00002
    • 2021-02-18
    81 min

    [ETQR-198][Daydream POV] Rich Sex With My Lovely S*****t In Uniform - Natsu Tojo

  • censoredcreampieuniformETQRerotic timeETQR-198ETQR198h-1186etqr00198
    • 2021-02-19
    53 min

    FC2PPV 1693327 Rio Yukopi Tech Game

  • amateur uncensoredfc2
    • 2021-02-26
    192 min

    [SABA-678]While Committing Adultery Sex, She Received A Call From Her Husband And When She Answered The Call While Fucking, That Sent Her Sensuality To The Max "I Told You Not To Fuck Me When I'm On The Phone, Ahhhhh!!!" And That's Ho

  • censoredbig titsSABAskyu shirotohasshiSABA-678SABA678h-244saba00678
    • 2021-03-17
    62 min

    492MERC-280 Gal Who Wants To Be A Wife

  • amateur censoredcreampieuniformmercmerc-280merc280492merc-280
    • 2021-03-21
    88 min

    490FAN-077 Yuria

  • amateur censoredmarried womanamateurfanfan-077fan077490fan-077
    • 2021-03-23
    129 min

    [SDAB-172]Adorable Art S*****t Takes Her 55-Year-Old Teacher's Creampie After School - Driving Footage - Sensitive, Slender Body Saya Kuriyama

  • saya kuriyama censoredcreampieschoolgirlSDABsod createrakudaone s youthSDAB-172SDAB1721sdab00172
    • 2021-03-24
    106 min

    459TEN-015 [Super-class God Milk] Charge into the home of an H-cup active female college student! !! Bombshell fuck with special game underwear! !! F cup in 5th grade, now H cup ridiculous god milk sparks a man’s instinct! !! Squeeze sperm with

  • amateur censoredbig titsamateurtenten-015ten015459ten-015
    • 2021-04-02
    120 min

    [ADN-306]I Fucked My S*****t At A Love Hotel So Many Times That We Ran Out Of Condoms Kana Kusakabe

  • kana kusakabe censoredbig titssingle workADNattackerskitorune kawaguchiotona no dramaADN-306ADN306adn00306
    • 2021-04-09
    149 min

    [IPX-643]Sacrificial Slut - Confined For 10 Days To Take Endless Loads From Older Guys With Huge Cocks Kana Momonogi

  • kana momonogi censoredsquirtingsingle workIPXidea pocketdishIPX-643IPX643ipx00643
    • 2021-04-09
    161 min

    [IPX-650]Spit-Swapping, Sizzling Hot Creampie Sex With A Knock-Out Hottie Miu Nakamura

  • miu nakamura censoredcreampieslutIPXidea pocketdishIPX-650IPX650ipx00650
    • 2021-05-05
    42 min

    279UTSU-508 Aki-san

  • amateur censoredcreampiemarried womanutsuutsu-508utsu508279utsu-508
    • 2021-05-18
    63 min

    200GANA-2489 In the spear room of the Nampa teacher of 100 battles, bring in SEX hidden shooting 203 Masturbate at the house and estrus! Dirty blonde white gal attacking herself! A lot of nasty feeling spree with a super piston! Hidden camera with be

  • amateur censoredamateurganagana-2489gana2489200gana-2489
    • 2021-05-27
    120 min

    [013ONEZ-291]完全主観 地味で真面目な会社の同僚が媚薬漬けに・・・ 日泉舞香

  • amateur censoredcreampieuniformonezonez-291onez291013onez-291
    • 2021-05-29
    116 min

    [BIJN-200]The Documentary Orgasmic Basic Instinct-Baring Sex We're Going To Fuck The Shit Out Of This Tanned Seriously Fucked Up Pussy Gal During This Orgy REMI

  • remi censoredsingle workBIJNbijin majo emmanuelleBIJN-200BIJN200bijn00200
    • 2021-06-15
    36 min

    481SACZ-041 Sachiyo 7

  • amateur censoredamateurmature womansaczsacz-041sacz041481sacz-041
    • 2021-07-07
    50 min

    FC2PPV 1882790 [Miracle reunion] [Sequel] Aimi 21 years old! Throat Deep Throat Raw Saddle Massive Facials With Super Big Cock To A Girl Who Is М! !!

  • amateur uncensoredfc2
    • 2021-07-14
    120 min

    [FOCS-010]"I'm Selling POV Videos With This Girl": Her Bastard Of A Boyfriend Tricks Her Into Filming A Threesome, But The Actor's Technique Is So Good Her Slut Switch Flips On! - Misa Amagami

  • misa tenjo censoredcreampiebig titsFOCSabc mousouzokufocusFOCS-010FOCS010focs00010
    • 2021-07-17
    119 min

    [NNPJ-462]A Tokyo Halo Girl. Fucking A Girl in an Overwhelmingly Cute Uniform. Beautiful Girl With a Cute Animal Personality & Perfect Grade Blowjob 3 Raw Blasts Suzu-chan

  • censoredcreampieuniformNNPJnanpa japanNNPJ-462NNPJ462nnpj00462
    • 2021-08-21
    119 min

    [GMEM-041]Crazy Confinement Episode 04: Crazy Pussy Filled With Made Pleasure - A Female Detective"s Shameful And Nasty Awakening Satomi Suzuki

  • satomi suzuki censoredsingle workGMEMavsbaba za babiiavscollector s goldGMEM-041GMEM041gmem00041
    • 2021-08-21
    138 min

    [TCD-280]Transgender - Sissy Training To The Limit! Ai Sato - Transgender Girl Tied Up And Turned Into A Slut.

  • airi sato censoredsingle workTCDtrans clubTCD-280TCD280tcd00280
    • 2021-08-22
    68 min

    HEYZO 2596 Amateur Girls In School Uniforms Enjoy Lesbian Play – Asuka Uchiyama – Yu Nagata

  • asuka uchiyama yu nagata uncensoredheyzo
    • 2021-09-16
    55 min

    10musume 091821_01 I Was Introduced To A G-Cup Busty Girl With A Cute Face Mirai Hayase

  • amateur uncensored10musume
    • 2021-09-17
    52 min

    285ENDX-359 Be Careful Of The Volume! Ahe Voice Is Too Big! G Cup JD Squirting Convulsions Acme Is Too Dangerous Video!

  • amateur censoredcreampiebig titsendxendx-359endx359285endx-359
    • 2021-09-25
    40 min

    450OSST-015 She’s An Older Sister Found In Korea, And She’s A Genuine Bitch Who Sprinkles Three Times A Week! Chestnut & Nipple Alive With Electric Attack! "Denma, Big Love! Japan, Big Love!"

  • amateur censoredamateurslutosstosst-015osst015450osst-015
    • 2021-10-15
    118 min

    [PRED-347]Husband Is Away On A Business Trip... My Father-in-law Takes Me Quietly By The Hips For Non-stop Body Shaking Fucking. Yuki Takeuchi

  • yuki takeuchi censoredcreampiesingle workPREDpremiumkyaputen ebaraelegancePRED-347PRED347pred00347
    • 2021-10-22
    122 min

    [ISRD-006]Female Teacher in... (Persuasion Suite), Ai Mukai

  • ai mukai censoreddeepthroatbdsmISRDdream tickettakuanvivid dori muchikettoISRD-006ISRD00624isrd00006
    • 2021-10-22
    159 min

    [CJOD-319]The Convenient Apartment Wife"s Midday Adultery. Countless Creampies Into The Frustrated Big Tits Body. Mina Kitano

  • mina kitano censoredcreampiebig titsCJODbitorendei yamaguchichijo hebunCJOD-319CJOD319cjod00319
    • 2021-10-22
    81 min

    FC2PPV 2365631 * Limited Time Price Until 10/28 [2480pt⇒1980pt] E-Cup Miracle Beautiful Breasts ★ Super Sensitive Body ★ Manju Massive Ejaculation Of Rich Sperm In The Fresh Pussy Of The Flood

  • amateur uncensoredfc2
    • 2021-10-23
    240 min

    [OKAX-779]The Call Girl I Picked Out Ended Up Being My Stepmom... 240 Minutes

  • censoredmature womanmomOKAXk m producedick mandokuokazuOKAX-779OKAX779okax00779
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-15
    38 min

    FC2PPV 2435332 * Only For The First Time 2780pt → 1980pt [Orgy] I’m Sorry I Don’t Have Enough Photos. The Translation Is Described In The Content. This Is A Pretty Maniac Post. The Reason Why The Two Families Exposed To The Lesbian Are Dist

  • amateur uncensoredfc2
    • 2021-11-26
    120 min

    [DFDM-024]Super Close! Meaty Oil Esthetic Takarada Monami

  • takarada monami censoredbig titshandjobDFDMwaap entertainmenteightcobra waapDFDM-024DFDM0242dfdm00024
    • 2021-11-26
    62 min

    300NTK-664 [Yodare Beauty Big Tits] [Beauty Complete Awakening] [Disturbance Gonzo 2nn] The Mouth On Kimatte Is Also Drooling And The Mouth Underneath Is Really Wet! !! Beautiful Big Breasts Swaying And Swaying De Nasty Nature Release Whitening Mochi

  • amateur censoredcreampiesquirtingntkntk-664ntk664300ntk-664



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download