censored housewife creampie delusion group javcensored




FC2SQTEMIDVMIDEDASDHODVSTARSAUKSKBIJULJUFEVENUAWDWAAAMEYDMILKMIAAATIDSHKDADNGVH

2020-09-08
131 min

[SDAB-140]Dripping With The Juices Of Young Lust Her Moist, Fresh Body Is Gushing Fluids, Sweat, Cum, And Semen! 7 Splattering Cum Shots!! A Naive And Innocent Girl From The Country! Miko Tanaka

  • miko tanaka censoredschoolgirlsingle workSDABsod createhajime yarigasakione s youthSDAB-140SDAB1401sdab00140
    • 2020-09-18
    80 min

    428SUKE-040 [Squeeze the lewd juice of a big tits gal! ] Revolutionize the tide sprinkler Mitsuki-chan. The weather is fine, but some flood warnings have been issued! Endlessly gushing masterpiece of sensitive continuous Squirting! Transcendental Nur

  • amateur censoredcreampiesquirtingsukesuke-040suke040428suke-040
    • 2020-09-21
    58 min

    FC2PPV 1509558 Insult a shy girl Yumi

  • amateur uncensoredfc2
    • 2020-10-04
    122 min

    [SOAN-050]Right About The Time I Devoted Myself To A Life Of Proctology As A Medical Practitioner, I Awakened To The Perverted Pleasures Of Anal Sex, And I Spent My Days Desiring A Way To Satisfy My Naughty Urges... Attended To By The Voluptuous Head

  • censoredanalnurseSOANyama to soramaketaro tanizokoanal visitSOAN-050SOAN050soan00050
    • 2020-10-17
    300 min

    [DVDMS-589]Face-Appearance Ban Lifted! Magic Mirror Flights, All 38+ Years Old! Hot Married Ladies Who Don't Feel Their Age, In Their First Public Deep Kiss Vol.07 10 Women Sex Special! French Kissing With Young Guys, They Get Steamed Up For The

  • censoredamateurDVDMSdeep sfunky hasegawathe magic mirrorDVDMS-589DVDMS589dvdms00589
    • 2020-10-19
    43 min

    305TRUMG-130 Shouko

  • amateur censoredamateurdramatrumgtrumg-130trumg130305trumg-130
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-10-24
    117 min

    [CJOD-262]She Gets Horny And Sweaty On Her Ovulation Day This Big Tits Wife Is Luring Her Next Door Neighbor To Creampie Sex Temptation Rika Tsubaki

  • tsubaki rika censoredcreampiebig titsCJODchijo heavenk westCJOD-262CJOD262cjod00262
    • 2020-10-24
    164 min

    [DASD-744]Semen Loving, Semen Addict Transsexual - Yura Tenshi

  • angel yura censoredblowjobbeautiful girlDASDdasnao masakiDASD-744DASD744dasd00744
    • 2020-11-13
    151 min

    [SCPX-409]That Delinquent Girl Who Used To Bully Me Back In School Is Now A Call Girl! If You're Truly Sorry, You'll Let Me Fuck You Bareback!!

  • censoredcreampieSCPXscoopmousouzokuSCPX-409SCPX409h-565scpx00409
    • 2020-11-14
    53 min

    H4610 gol203 Asami Chinen 20years old

  • amateur uncensoredh4610
    • 2020-12-10
    45 min

    FC2PPV 1601490 [Almost appearing] A slender body nympho married woman, a high-speed self-piston straddling the cock so that the generalized erogenous zone w sticks after drinking Ai ○. De transformation married woman w who rolls up

  • amateur uncensoredfc2
    • 2020-12-17
    478 min

    [OFJE-288]Rara Anzai 2nd BEST Collection

  • anzai rara censoredbig titssingle workOFJEs1 no 1 styleOFJE-288OFJE288ofje00288
    • 2020-12-18
    96 min

    [VEMA-154]A 3-Day, 2-Night Creampie School Trip Where All The Boys Join So They Can Fuck The Colossal Tits Female Teacher June Lovejoy

  • june lovejoy censoredcreampiemature womanVEMAvenuspetermegami venusVEMA-154VEMA154vema00154
    • 2020-12-25
    239 min

    [MBM-250]The Other Side Of Karina Nishida BEST

  • nishida karina censoredanalcreampieMBMprestigejanhirombmMBM-250MBM250118mbm00250
    • 2020-12-29
    139 min

    [STARS-311]Cowgirl Practice With The Busty Babe In The Next Room Hibiki Natsume

  • natsume hibiki censoredbig titssingle workSTARSsod createkyoseisod starSTARS-311STARS3111stars00311
    • 2020-12-30
    68 min

    FC2PPV 1626104 [First shot] Shinmama who is shy and innocent remains and dense etch for the first time in half a year ❤️❤️

  • amateur uncensoredfc2
    • 2021-01-07
    486 min

    [CVDX-430]Oh My, You're Still Hard After Squeezing Out A Cum Shot!! This Beautiful And Pretty Married Woman Is Giving Me A Handjob! And Blessing Me With Creampie Raw Footage! I Got Fucked Until My Cock Went Crazy. 60 Cum Shots 30 Ladies 8 Hours 2

  • censoredcreampiemarried womanCVDXcenter villageCVDX-430CVDX430h-086cvdx00430
    • 2021-01-12
    42 min

    FC2PPV 1641977 ☆ First shot ☆ 170cm model class style beauty ♥ Oma ○ This is an irresistible erotic gap of unprocessed bristles ♪ It is NG to appear, but I will cum inside with the first Gonzo ♥ [With review benefits]

  • amateur uncensoredfc2
    • 2021-01-12
    134 min

    [MSFH-047]Follow-Up Ejaculation Action At The Men's Massage Parlor, Where They Won't Be Satisfied Until They Milk You Of Every Last Drop Of Semen And Empty Your Balls Dry Ami Kitai

  • kiyo ami censoredbig titshandjobMSFHsod createhirokoji osakims sodMSFH-047MSFH0471msfh00047
    • 2021-01-15
    67 min

    FC2PPV 1645984 [Uncensored] Healing Menes Bishoujo Yui-chan’s black pantyhose tight mini dress and seeding press on the verge of brain !! Miss Menes: Yui-chan (19 years old) ③

  • amateur uncensoredfc2
    • 2021-01-18
    82 min

    259LUXU-1358 Luxury TV 1354 3rd year of marriage … A slender wife who suffers from sexlessness appears! It contains a warped big cock that is incomparable to her husband, and even though saliva drips like an unpleasant throat, she has an ecstati

  • amateur censoredbig titsmarried womanluxuluxu-1358luxu1358259luxu-1358
    • 2021-01-20
    120 min

    [GVH-184]She Doesn't Want To Waste Any Semen, So She'll Lick It All Down For A Cum Swallowing Good Time! This Semen-Saver Mama Is Not Wasting Any Tissues And Helping Out The Environment Yuri Sasahara

  • yuri sasahara censoredslutmomGVHglory questkabin kizakuraGVH-184GVH18413gvh00184
    • 2021-01-21
    40 min

    FC2PPV 1653242 [Virgin x K Cup] F〇7 Tee Big Breasts K Fucking / Creampie! Virgin-kun forgets himself in the overwhelming size of clothes fucking and makes his dream come true * Nothing to do! * Complete appearance, vaginal cum shot, graduation from v

  • amateur uncensoredfc2
    • 2021-01-31
    65 min

    476MLA-028 [God Blow polished by pillow business] G beauty busty hostess panting with [Kansai dialect]! Nampa teacher declares defeat by terrible mouth tech! ？？ I’m crazy in the back of my vagina [Pool Nampa] Gonzo SEX! !!

  • amateur censoredamateurmlamla-028mla028476mla-028
    • 2021-02-11
    58 min

    FC2PPV 1681825 First shot Former spear ○ N’s 20’s married woman It feels too good to be a partner for the first time in 2 years since I finished giving birth

  • amateur uncensoredfc2
    • 2021-02-12
    96 min

    300NTK-517 “I want more …” G cup Echi Echi Megumi cute junior! !! really! !! really! !! Straight! !! Too cute too erotic God correspondence! !! Co-co wanting is a binkan constitution! !! Beloved and foolery getting wet with a kiss! !!

  • amateur censoredcreampiebig titsntkntk-517ntk517300ntk-517
    • 2021-03-25
    240 min

    [SW-764]All In The Family Daydream - Special Edition. Stepson Gets Hard Over His Stepmom's Hot Bod. "We'll Keep This A Secret From Daddy" She Kindly Cradles His Cock, Then Uses It To Slake Her Lust - 15 Horny MILF SPECIAL!

  • censoredmilfSWswitchyocchanswitch switchSW-764SW7641sw00764
    • 2021-04-03
    125 min

    [TSF-017]Male Office Worker (Age 24) Wakes Up One Morning To Find Himself Transformed Into A Woman - The Stud She Meets On A Dating App Awakens Her Pussy And Transforms Her Into A Raging Slut Kenji Mizuta

  • kenji paddy censoredcreampiecosplayTSFkaguyahimept mousouzokugynecomastia reportTSF-017TSF017tsf00017
    • 2021-04-10
    187 min

    [DGCESD-991]Delivery Only! With Bonus Video We Only Filmed The Things That Kana Morisawa Wanted To Do

  • kana morisawa kanako iioka censoredcosplaymature womanDGCESDcelebrity friendsDGCESD-991DGCESD991dgcesd00991
    • 2021-04-20
    55 min

    H0930 ki210420 Youko Higashi 22years old

  • amateur uncensoredh0930
    • 2021-04-24
    69 min

    H0930 ki210425 Rinako Fujimoto 28years old

  • amateur uncensoredh0930
    • 2021-05-07
    108 min

    [FTHT-013](An Endless Loop Of Deep Throat Dick Sucking! Furious Chain Reaction Of Piston-Pumping Reactions" Unstoppable Pissing!) A Baby-Faced Babe With Big Tits Is Relentlessly And Continuously Getting Her Throat Skewered With Cocks! Suffocating

  • censoredcreampiebig titsFTHTfalenodavielfalenotubeFTHT-013FTHT0131ftht00013
    • 2021-05-07
    120 min

    [RCTD-399]Daydream Item: Ultimate Evolution Series, "Out Of Eyes" A Tablet That Makes You Disappear

  • hinako mori pure white reina censoredschoolgirlRCTDrockettaro kanbeRCTD-399RCTD3991rctd00399
    • 2021-05-11
    127 min

    [KMHRS-043]The Dream Of Meru's Most Devoted Follower: Licking And A First Creampie (Heart) - Meru Kusumi

  • kusumi censoredcreampieamateurKMHRSsod createtiger kosakaikimihoreKMHRS-043KMHRS0431kmhrs00043
    • 2021-05-28
    127 min

    [NAD-003]This Gal Is Taking My Nipples

  • censoredamateurNADdream ticketpiromu matsukataNAD-003NAD00324nad00003
    • 2021-06-01
    55 min

    HEYZO 2536 My Soaked Female Colleague Made Me Become Horny! – Eri Saeki

  • eri saeki uncensoredcreampieheyzo
    • 2021-06-08
    119 min

    [SDDE-648]Hard Pounding Only - Quickie At The Gym - Training Up To The Ultimate Ecstasy While Building Beautiful Bodies -

  • chanyota tsujii honoka censoredsquirtingSDDEsod createdainanasenzSDDE-648SDDE6481sdde00648
    • 2021-06-12
    146 min

    [CEMD-018]These Women Are Masochists! The Desperation Of 3 Lesbian Masochistic Women! Only The Biggest Masochists Understand The Extraordinary Pleasure That Awaits Beyond The Pain!

  • aya shiomi yuri sasahara censoredlesbianmature womanCEMDceleb no tomoCEMD-018CEMD018cemd00018
    • 2021-06-16
    125 min

    [GVH-246]Naughty Nurses Satomi Suzuki

  • satomi suzuki censoredcreampiegrandfatherGVHglory questham the mcGVH-246GVH24613gvh00246
    • 2021-07-10
    63 min

    FC2PPV 1914070 [Personal shooting / leakage] [Secret personal photo session] with active students and underground idols Forbidden Gonzo video with her [Chibi Manko]

  • amateur uncensoredfc2
    • 2021-07-14
    134 min

    [GVH-262]Bossy Female CEO And Her Horny Stepson Mio Kimijima

  • kimishima mio censoredcreampiebig titsGVHglory questhyonGVH-262GVH26213gvh00262
    • 2021-07-19
    53 min

    328HMDN-384 [Personal Shooting] A Major Cosmetics Manufacturer Sales Harrun The Lascivious Nature Of A Neat And Clean Office Lady! Ejaculation Management While Spoiling With F Cup Beauty Big Tits Shaved Body That Captivates A Man Boobs Bouncing With

  • amateur censoredcreampiebig titshmdnhmdn-384hmdn384328hmdn-384
    • 2021-07-25
    63 min

    Caribbeancom 072521-001 3 Holes Cum Dumpster Rin Aizawa

  • rin aizawa uncensoredanalcreampiecaribbeancom
    • 2021-07-29
    113 min

    [KAAD-055]My Home"s Beautiful Mother-in-law - Miyako Hori

  • miyako hori censoredcreampiemarried womanKAADcenter villagejiro fukagawahanazono center villageKAAD-055KAAD055h-086kaad00055
    • 2021-08-10
    131 min

    496SKIV-016 Nazuna-Chan (21) 2

  • amateur censoredcreampieamateurskivskiv-016skiv016496skiv-016
    • 2021-08-14
    120 min

    [AQSH-074]Firing The Husband Who"s Happy Because He Bought A Home! The Subordinate"s Wife Who Was Creampied Even Though She Asked Him Not To Because She"s On A Dangerous Day. Miho Tono

  • miho tsuno censoredcreampiemature womanAQSHaqua mall heroaqua mallAQSH-074AQSH074aqsh00074
    • 2021-08-15
    58 min

    HEYZO 2592 Pumping Into An Amateur Girl! – Hitomi Okano

  • hitomi okano uncensoredcreampieheyzo



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download