censored digital mosaic javcensored mature woman jav




FC2AVSAAUKGKSBJNATRGVHMEYDSHKDHDKAHMNFSDSSNACRHODVMARAMILKCJODAPODGMEMPPPDNGODHZGD

2020-09-20
117 min

[JUL-318]Madonna Exclusive 2nd Round!! Creampie Revealed!! Losing Her Mind In The Heatwave, This Stepmom Has A Sweaty Adulterous Fuck When Returning Home. Nanako Ise

  • nanako seto censoredcreampiemature womanJULmadonnamametaro mamezawaJUL-318JUL318jul00318
    • 2020-09-08
    140 min

    [KIRE-002]Brains And Beauty: Real-Life Esthetician 41-Year-Old Mariko Sata's Porn Debut

  • mariko sada censoredmature womansingle workKIREsod createeasy matsumotobeauty kirei sodKIRE-002KIRE0021kire00002
    • 2020-09-05
    178 min

    [URE-057]A Madonna Exclusive This Married Woman Was Exposed In All Her Lustful Glory By The Desires Of Young Men, And Now We're Bring It To You In Live-Action!! Based On: A MILF Shobo Publication I'm Going To Fuck My Favorite Auntie Ayumi Miu

  • ayumi miura censoredbig titsmature womanUREmadonnakitorune kawaguchiure.comiURE-057URE057ure00057
    • 2020-09-05
    120 min

    [JUL-305]I Secretly Want You To Fuck My Wife... - Her Husband Has Cuckold Fantasies And Planned Out A Creampie Adultery Fuck Fest - Nao Jinguji

  • jinguji temple nao censoredbig titsmature womanJULmadonnatakeshi kogaJUL-305JUL305jul00305
    • 2020-09-05
    118 min

    [JUL-302]A Husband And Wife Swapping NTR Shocking Videos Of Infidelity Between His Wife And Friend, Fucking By The Window Ririko Kinoshita

  • kinoshita rinko censoredbig titsmature womanJULmadonnanagaeJUL-302JUL302jul00302
    • 2020-09-05
    117 min

    [JUL-313]This Husband And Wife Went On A Training Trip And Fucked This Married Woman Employee Behind Her Husband's Back Momoko Isshiki

  • momoko isshiki censoredmature womansingle workJULmadonnanagaeJUL-313JUL313jul00313
    • 2020-09-05
    120 min

    [OBA-406]I'm Just An Old Lady, But Do You Really Want To Fuck Me...？ - Hungry Flesh Fantasy Sex With Her Husband's Co-Worker - Kyoko Harada

  • kyoko harada censoredbig titsmature womanOBAmadonnabieber gonzoobasanOBA-406OBA406oba00406
    • 2020-09-05
    143 min

    [JUL-311]This Slug Stepdaddy Will Relentlessly Lick Your Entire Body In Sticky Sex Aoi Mukai

  • ai mukai censoredmature womansingle workJULmadonnasatsugu koyamaJUL-311JUL311jul00311
    • 2020-09-05
    120 min

    [JUL-314]I Left My Lady-Loving Dad With My Pushover Wife, And Went On A 3-Day, 2-Night Business Trip... Sara Kagami

  • kagami sara censoredmature womansingle workJULmadonnamametaro mamezawaJUL-314JUL314jul00314
    • 2020-09-05
    119 min

    [JUL-306]After Your Graduation... Now That You're An Adult, You Received A Gift From Your Stepmom... Kana Mito

  • kana mito censoredcreampiemature womanJULmadonnahimu lockJUL-306JUL306jul00306
    • 2020-09-05
    119 min

    [JUL-309]With Only 1 Month To Go Until The End Of The World, I Decided To Fuck My Long-Lost Love From My S*****t Days Until My Husband With Whom I Spent Many Years Together... Rei Kuruki

  • satoshi kuruki censoredmature womansingle workJULmadonnamametaro mamezawaJUL-309JUL309jul00309
    • 2020-09-05
    159 min

    [JUL-303]This Late-Blooming Married Woman Is Blossoming Like Crazy A Former Stage Actress Married Woman Tsubaki Yukino 30 Years Old Her Adult Video Debut!!

  • yukino tsubaki censoredmature womansingle workJULmadonnahimu lockJUL-303JUL303jul00303
    • 2020-09-05
    119 min

    [JUL-310]My New Stepmom - My Favorite Woman Is Now My Stepmom - Yumi Sakurai

  • yumi sakurai censoredmature womansingle workJULmadonnajyoji kawaiJUL-310JUL310jul00310
    • 2020-09-05
    118 min

    [JUL-308]A Married Woman Who Broke The Rules Of Cuckold Sex - One By One, She Accumulated Crimes And Lies Against Her Husband - Maki Hojo

  • hojo asahi censoredmature womansingle workJULmadonnashiro shotenJUL-308JUL308jul00308
    • 2020-09-05
    137 min

    [JUL-312]The Insensitive Married Woman Slut From Next Door Drove This Obsessive Compulsive Maso Man Insane Yuko Shiraki

  • shiraki yuko censoredmature womanslutJULmadonnanao masakiJUL-312JUL312jul00312
    • 2020-09-05
    118 min

    [JUL-307]You'll Want To Grab Hold Of Those G-Cup Titties Her First Appearance On The Madonna Label!! After Having Babymaking Sex With Her Husband, She Always Gets Continuously Creampie Fucked By Her Father-In-Law... Nene Tanaka

  • nene tanaka censoredcreampiebig titsJULmadonnajotaro tomiJUL-307JUL307jul00307
    • 2020-09-05
    120 min

    [JUL-304]My Mom's Friends Tsubaki Kato

  • kato camellia kaoru natsuki censoredmature womanslutJULmadonnajyoji kawaiJUL-304JUL304jul00304
    • 2020-09-05
    146 min

    [JUL-301]The Year, 2020, Summer, Shocking. This Married Woman Is A Former TV Commercial Actress Hiroka Suzuno 36 Years Old Her Adult Video Debut!!

  • hiroka suzuno censoredmature womansingle workJULmadonnamametaro mamezawaJUL-301JUL301jul00301
    • 2020-08-28
    120 min

    [NEM-042]Genuine Abnormal Sex A Fifty-Something Stepmother And Her Stepson Chapter Sixteen A Stepmom Is Pleasured By Her Stepson's Thick Jellyroll Misato Shibasaki

  • misato shibasaki censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-042NEM042143nem00042
    • 2020-08-28
    121 min

    [SGM-037]New - Beautiful Mature Woman Bathhouse, Passionate High Class Soapland Ayame Ichinose

  • ichinose ayame censoredcreampiebig titsSGMglobal media entertainmentyayoi nakanosuper global mediaSGM-037SGM037143sgm00037
    • 2020-08-28
    120 min

    [SGM-038]The Showa Era Sad Ladies Who Lived Through War A Married Woman Who Became A Comfort Woman For The Soldiers And Her Father-In-Law Yu Kawakami

  • yu kawakami morino morino censoredcreampiemature womanSGMglobal media entertainmentkikujiro akabanesuper global mediaSGM-038SGM038143sgm00038
    • 2020-08-28
    120 min

    [SGM-039]The Infected Family Is This A Lust Virus Pandemic!？ This Eronavirus Will Cause A 100 Horniness Rate That Will Cause Anyone Who Gets Infected To Uncontrollably Want Sex, And Now, This Disease Has Spread Across The World. My Stepmother And Ste

  • mari aoi naoko yokoyama censoredcreampiebig titsSGMglobal media entertainmentkikujiro akabanesuper global mediaSGM-039SGM039143sgm00039
    • 2020-08-22
    119 min

    [JUL-299]"Hey... Are You Really A Virgin？" Married Woman Tricked By Fake Cherry Boy - Shuri Yamaguchi

  • yuri yamaguchi censoredbig titsmature womanJULmadonnajotaro tomiJUL-299JUL299jul00299
    • 2020-08-22
    119 min

    [JUL-300]Mon, Wed, Fri: On Trash Pickup Day, This Married Woman Secretly Gets A Creampie Quickie - Yuka Oshima

  • yuka oshima censoredcreampiebig titsJULmadonnahey yo sukeJUL-300JUL300jul00300
    • 2020-08-22
    140 min

    [JUL-292]The BEAUTIFUL WIFE 05 Ririka Mori, 32 Years Old, AV Debut!!

  • forest pear flower censoredmarried womanmature womanJULmadonnamamezawa mametaroJUL-292JUL292jul00292
    • 2020-08-22
    144 min

    [JUL-290]Pure Heart, Sensitive Body. Married Woman Gets Turned On Easily! Nanako Seto, 35, AV Debut!!

  • nanako seto censoredmature womansingle workJULmadonnamametaro mamezawaJUL-290JUL290jul00290
    • 2020-08-22
    140 min

    [JUL-295]Bright Red Rouge Suits Her: Super Sexy Married Woman Yuna Mitake's AV Debut!!

  • yuna mitake censoredbig titsmarried womanJULmadonnamamezawa mametaroJUL-295JUL295jul00295
    • 2020-08-22
    117 min

    [JUL-291]I Lost My Mind After 7 Days Of Being Fucked By My Husband's Boss... Airi Kijima

  • airi kijima censoredmature womansingle workJULmadonnatakeshi kogaJUL-291JUL291jul00291
    • 2020-08-22
    120 min

    [JUL-296]The Place I Moved Into Is A Middle-aged Hell. Babymaking Agency - Urara Hanane

  • hanaoto urara censoredcreampiemature womanJULmadonnajotaro tomiJUL-296JUL296jul00296
    • 2020-08-22
    147 min

    [JUL-297]On A Summer Day So Hot You Could Boil Water, My Neighbor Came Inside Me Over And Over Again... Maki Tomoda

  • maki tomoda censoredcreampiemature womanJULmadonnasatsugu koyamaJUL-297JUL297jul00297
    • 2020-08-22
    120 min

    [OBA-403]Together With My Friend's Mother Until The Break Of Dawn... Natsuko Kayama

  • natsuko kayama censoredbig titsmature womanOBAmadonnabieber gonzoobasanOBA-403OBA403oba00403
    • 2020-08-22
    119 min

    [JUL-293]Married Office Lady's Total Domain: Slender Married Woman Shamefully Does What She's Told At The Office - Natsuki Takeuchi

  • natsuki takeuchi censoredmature womansingle workJULmadonnajotaro tomiJUL-293JUL293jul00293
    • 2020-08-22
    120 min

    [JUL-294]Swimming School NTR: Shocking Creampie Footage Of Married Woman Taken By Her Instructor's Kindness - Ai Arakawa 7

  • aishin shinkawa censoredcreampiebig titsJULmadonnarokusaburo mishimaJUL-294JUL294jul00294
    • 2020-08-22
    120 min

    [JUL-298]The Last Secret Meeting: Loving Sex Before Their Last Farewell - Hikari Kisaki

  • hikari hime censoredbig titsmarried womanJULmadonnatakeshi kogaJUL-298JUL298jul00298
    • 2020-08-22
    120 min

    [OBA-404]"It's Just Going To Be This One Time... Okay？" While My Wife Was Away, I Spent 4 Days And 3 Nights Secretly Fucking My Stepmom Sayako Sanada

  • sanada sanako censoredbig titsmature womanOBAmadonnabieber gonzoobasanOBA-404OBA404oba00404
    • 2020-08-22
    120 min

    [JUL-232]I Was On My Way To Work, And This Female Associate Who Worked For My Client Came At Me And Made Me Cum, Over And Over Again Akari Neo

  • akari neo censoredmature womanslutJULmadonnabieber gonzoJUL-232JUL232jul00232
    • 2020-08-02
    110 min

    [ANB-177]Beautiful, Dirty Step Aunt's Big Tits And Thick Body Cover Me, Riko Tokushima

  • riko tokushima censoredbig titsmature womanANBrubysusumu yanokuchinobleANB-177ANB177anb00177
    • 2020-08-02
    100 min

    [AED-184]Forbidden Relationships - A 50-Something Stepmom Gets Creampied - Sayako Sanada

  • sanada sanako censoredcreampiebig titsAEDrubysusumu yanokuchieden rubyAED-184AED184aed00184
    • 2020-08-02
    120 min

    [ANB-176]I Became My Stepmom's Sex Toy, Beautiful And Slutty Stepmom's Lust! Ayaka Muto

  • ayaka muto censoredbig titsmature womanANBrubysusumu yanokuchinobleANB-176ANB176anb00176
    • 2020-07-24
    120 min

    [NEM-040]True Strange Desires Stepmom In Her 40s And Stepson No.12 Proud Masochist Stepmom Breaking In Her Stepson Shoko Ueki

  • shoko ueki censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-040NEM040143nem00040
    • 2020-07-24
    120 min

    [NEM-041]True Strange Desires Stepmom In Her 50s And Stepson No.15 Cherry Boy Stepson Goes Deep Into A Ripe Pussy Orie Maya

  • orie maya censoredcreampiebig titsNEMglobal media entertainmentyayoi nakanonewmomNEM-041NEM041143nem00041
    • 2020-07-19
    184 min

    [HNDS-070]She's Celebrating Her 30th Year In The Adult Video Industry A Diet Variety Special To Transform Into A Bewitching Beauty! Natsuko Wants To Get Back Her Small Waist Again Natsuko Kayama

  • natsuko kayama censoredcreampiebig titsHNDShon nakaHNDS-070HNDS070hnds00070
    • 2020-07-19
    120 min

    [JUL-280]Madonna Exclusive - A Married Woman Seeks Sexual Healing In The Arms Of Another Man! - Comforted By Adultery - Marina Shiraishi

  • rena shiraishi censoredbig titsmarried womanJULmadonnarokusaburo mishimaJUL-280JUL280jul00280
    • 2020-07-19
    150 min

    [JUL-283]A Passing Hot Spring Resort Adultery Affair - Since You Won't Pay Any Attention To Me... I Decided To Fuck Another Man - Rin Kira

  • kira rin censoredmature womansingle workJULmadonnabieber gonzoJUL-283JUL283jul00283
    • 2020-07-19
    120 min

    [JUL-265]"We've Missed The Last Train..." - A Female Boss Seduces Her Younger Male Colleague With Her Sexy Smile - Ayaka Mutou

  • ayaka muto censoredbig titsmature womanJULmadonnashiro shotenJUL-265JUL265jul00265
    • 2020-07-19
    150 min

    [JUL-268]I Was The Only Single Guy That Summer... During My Trip Home, My Two Big Stepsisters And I Engaged In Sweaty Creampie Sex

  • yoshine yuria really censoredcreampiebig titsJULmadonnaeitaro hagaJUL-268JUL268jul00268
    • 2020-07-19
    120 min

    [JUL-263]I Went To Fetch My Big Stepsister So I Could Fuck Her Tonight. Aoi Mukai

  • ai mukai censoredcreampiemarried womanJULmadonnahimrockJUL-263JUL263jul00263
    • 2020-07-19
    120 min

    [JUL-282]My Mom Got Fucked By My Bully Classmate Yuka Oshima

  • yuka oshima censoredbig titsmature womanJULmadonnajyoji kawaiJUL-282JUL282jul00282



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download