censored creampie uniform javcensored def




FC2LULUMIDEMILKMEYDWAAANATRFSDSSSTARSCJODAPODADNCESDHZGDRBDSPRDIPXHUNTBVENXABWKBI

2018-06-22
253 min

[BAZX-141]Total Domain: Knee-high maniacs 2

  • censoredcreampieschoolgirlBAZXmedia stationone topbazookaBAZX-141BAZX14161bazx00141
    • 2018-06-21
    233 min

    [IENE-903]We Discovered This Minimal And Pure And Innocent Young Girl In Yoyogi, And Had Her Pussy Grind Our 18cm Mega Sized Cocks, And This Is How Nasty And Naughty Things Got 2

  • censoredcreampieamateurIENEi energychrysanthemumie nergyIENE-903IENE9031iene00903
    • 2018-06-18
    106 min

    [XVSR-388]Massive Climax X Max Convulsions Crazy Creampie Trembling Sex Ai Hoshina

  • sena ai censoredcreampieschoolgirlXVSRmax ashanti yazawacalenXVSR-388XVSR388xvsr00388
    • 2018-06-18
    149 min

    [APKH-069]The Girl With The Biggest G Cup Titties At School Is Lusting For Love, And Soiling Her Tatami Mats And Futon With Her Pussy Juices And Drool, And Defiled With Lewd And Crude Dirty Old Man Sex... Nao Kiritani

  • naoki kiritani censoredcreampiebig titsAPKHaurora project annexAPKH-069APKH069apkh00069
    • 2018-06-16
    118 min

    [MXGS-1057]I Was At A Massage Parlor Where The Massage Therapist Kept Luring Me To Temptation By Flashing Panty Shot Action At Me, So I Slammed Her Against The Walls And The Floors And Shoved My Cock Inside Her And Made Her Spasm With Pleasure And Th

  • otsuki sound censoredcreampieuniformMXGSmaxingMXGS-1057MXGS1057h-068mxgs01057
    • 2018-06-15
    237 min

    [HUNTA-457]I Was Giving My Childhood Friend A Massage And Stimulating All Of Her G-Spots When She Suddenly Started To Spasm And Had Violent Orgasms! I'm A Dumb, Un-Athletic Loser Studying To Re-Take My Entrance Exams! My Childhood Friend Came Ove

  • censoredcreampiebig titsHUNTAhuntermorikihhh groupHUNTA-457HUNTA457hunta00457
    • 2018-06-15
    129 min

    [TIKP-021][Pregnancy Fetish Videos] She May Look Naive And Innocent, But This Beautiful Girl Is Volunteering To Appear In This AV Because She Wants To Have Sex With You! This Divinely Cute Girl Has Been Storing Up All Of Her Lust And Now She's Ha

  • censoredcreampieTIKPchikikikikama delusion groupTIKP-021TIKP021tikp00021
    • 2018-06-14
    226 min

    [GAPL-029]At This Hospital Designated By A Famous Young Ladies' School, All The Girls In Uniform Who Cum Here For Their Checkups Are Always Going To Be Stripped Down To Their Underwear! These Exhibitionist Bitches Are Showing Off Their Titties An

  • censoredcreampiebeautiful girlGAPLgreen applehhh groupGAPL-029GAPL029gapl00029
    • 2018-06-10
    150 min

    [CHRV-060]This Loser Unmarried Business Man Has Nothing, And No Money, But One Day On His Day Off, He Found These Maso Beautiful Runaways With Amazing Big Tits Worth More Than One Look!

  • censoredcreampiebig titsCHRVcherries rebo delusioncherries reboCHRV-060CHRV060chrv00060
    • 2018-06-09
    118 min

    [MUDR-038]Ever Since That Day, I've Always Been... A Beautiful Young Girl In Uniform In S&M Breaking In Training Konomi Nishimiya

  • konomi nishinomiya censoredcreampiedramaMUDRinnocentMUDR-038MUDR038mudr00038
    • 2018-06-08
    120 min

    [XRW-489]What If... You Could Earn 100,000 Yen By Becoming Sex Toys For A Gal... ACT.001 Erica Saeki

  • erika kashiwagi censoredcreampieblowjobXRWreal workstodoreal real worksXRW-489XRW489172xrw00489
    • 2018-06-08
    162 min

    [MDTM-374]Super Horny Girls from an Elite Girls School Show Us Their True Colors 01

  • censoredcreampieschoolgirlMDTMmedia stationsuginokispace planningMDTM-374MDTM37461mdtm00374
    • 2018-06-08
    150 min

    [MDTM-371]How to Nurture Nasty Schoolgirls: A Teacher's Method. Ayuri Sonoda

  • ayuda hamada censoredcreampieschoolgirlMDTMmedia stationskillful between floorsspace planningMDTM-371MDTM37161mdtm00371
    • 2018-06-08
    197 min

    [BAZX-139]Sex With A Hard-Working Newly Graduated Business Woman vol. 005

  • censoredcreampieuniformBAZXmedia stationtodobazookaBAZX-139BAZX13961bazx00139
    • 2018-06-08
    122 min

    [SUPA-334]Beautiful Girl In Uniform After School Sari

  • censoredcreampiebig titsSUPAclass s amateurjohnny shibuyaSUPA-334SUPA334h-244supa00334
    • 2018-06-08
    171 min

    [MDB-902]Picking Up Girls And Soliciting Customers For Sex In Ikebukuro/Shinjuku/Nakano

  • censoredcreampiebig titsMDBmedia stationtaro kbazookaMDB-902MDB90261mdb00902
    • 2018-06-01
    124 min

    [ONEZ-143]A Little Devil Schoolgirl Who Is Waiting For A Miracle FILE.001 Erica's Situation

  • censoredcreampieblowjobONEZprestigetodoonezONEZ-143ONEZ143118onez00143
    • 2018-06-01
    125 min

    [ONEZ-142]#Creampie Raw Footage Dispatch Maid Reflexology Service Vol.004 Miho Sakasaki

  • miho sakazaki censoredcreampieuniformONEZprestigeken sakumaonezONEZ-142ONEZ142118onez00142
    • 2018-06-01
    127 min

    [SS-136]Amateur Sailor Cosplay Creampie (All New) 136 Wakana A Beautiful Girl In A Sailor Uniform x 95cm G Cup Titties x Creampie Raw Footage!!

  • censoredcreampiebig titsSSplumamateur only plumSS-136SS136h-113ss00136
    • 2018-05-25
    120 min

    [XRW-480]An Ovulation Day Babymaking Sex Life With A Cum Crazy Premature Ejaculating Little Sister Ai Hoshina ACT.007 007

  • sena ai censoredcreampiebeautiful girlXRWreal workstodoreal real worksXRW-480XRW480172xrw00480
    • 2018-05-25
    118 min

    [LOL-164]Lolita Special Course A Little Lover's Shaved Pussy Development Journal Maina Yuri

  • yuuri censoredcreampiebeautiful girlLOLgrayslori senkaLOL-164LOL16412lol00164
    • 2018-05-25
    151 min

    [MDTM-364]An Obedient Schoolgirl Who Wants To Be Toyed With By Men Creampie Raw Footage Sex With A Totally Cute Beautiful Girl Rino Sasanami

  • sasanami censoredcreampieschoolgirlMDTMmedia stationannie nakamuraspace planningMDTM-364MDTM36461mdtm00364
    • 2018-05-25
    241 min

    [OKAX-383]This Is The Truth! Real Sex With Schoolgirl Babes Who Work At Underground Sex Clubs! 4 Hours

  • censoredcreampieschoolgirlOKAXkm produceside dishesOKAX-383OKAX38384okax00383
    • 2018-05-24
    216 min

    [SDMU-822]The Magic Mirror Number Bus "The Truth Is, I Can't Cum With Pussy Sex..." A Kind And Gentle, Real Life Nurse Will Solve Ejaculatory Problems With Creampie Sex Using Her Pussy!! 4

  • censoredcreampieuniformSDMUsod createsaijo akiramagic mirrorSDMU-822SDMU8221sdmu00822
    • 2018-05-24
    242 min

    [SVDVD-663]The Magic Mirror Number Bus Hard Boiled We Went To A Real Life Nurse And Said To Her, "I'm A Medical Intern Here, And I Need You To Participate In An Experiment For A New And Advanced Treatment" Which We Call The Picking Up Gir

  • censoredcreampiesquirtingSVDVDsadistic villagenew kazi kazamaSVDVD-663SVDVD6631svdvd00663
    • 2018-05-24
    161 min

    [MIST-211]We Went To A JK Reflexology Salon Where You Only Get To "Hug/Sleep Next To A Girl/And Sleep In Her Arms" And We Secretly Had Pay-For-Play Creampie Sex 4

  • akari shinmura miori hara censoredcreampieMISTmr michiruMIST-211MIST2111mist00211
    • 2018-05-21
    150 min

    [APKH-067]Tongue Techniques, Mouth Techniques, Handjob Techniques, And Pussy Pleasures! These Are All Rich And Thick Amazing Sexual Techniques! "After All, I'm Hooked On Having Sex Every Day In My Private Life Too" Haru Sakura

  • sakura haru censoredcreampieAPKHaurora project annexAPKH-067APKH067apkh00067
    • 2018-05-21
    118 min

    [XVSR-380]A Creampie Sex Video Record Of A Little Devil Female Student Who Loves Dirty Old Men Ayumi Kimito

  • kimi and ayumi censoredcreampieXVSRmax asono kancalenXVSR-380XVSR380xvsr00380
    • 2018-05-20
    89 min

    [MOKO-004]Do Ripe Mature Woman Babes Get Horny Anytime, Anywhere!？ What Happens When We Give This Cleaning Lady The Molester Treatment In Her Voluptuous Ass...

  • censoredcreampieuniformMOKOstar paradisejackalconvex roadMOKO-004MOKO004h-254moko00004
    • 2018-05-13
    150 min

    [CHRV-058]This Cherry Boy-Popping Little Sister Has Big Tits Worth More Than Just One Look! Secret Technique Initiation! A Little Sister Who Will Pussy Spasm Over And Over Again Until She Pops That Cherry Boy!

  • censoredcreampiebig titsCHRVcherries rebo delusioncherries reboCHRV-058CHRV058chrv00058
    • 2018-05-13
    150 min

    [CHRV-059]Directed By Kaho Shibuya Starring Kaho Shibuya (As Her Little Sister) A Total Kaho Shibuya Production Her Little Sister Has Big Tits Worth Seeing More Than A Single Look!

  • censoredcreampiebig titsCHRVcherries rebo delusioncherries reboCHRV-059CHRV059chrv00059
    • 2018-05-12
    107 min

    [MUKD-454]With This Handjob, I Can Cum Over And Over Again! She's Got A Plain Jane Face But She Gives A Handjob That Feels Better Than Any Pussy Because This Heaven-Sent Mistress Has The Ultimate Handjob Technique!

  • censoredcreampieschoolgirlMUKDinnocentMUKD-454MUKD454mukd00454
    • 2018-05-12
    146 min

    [MIAE-237]My Cute Little Sister Was Forced to Marry Some Middle Aged Guy, Ai Hoshina

  • sena ai censoredcreampiesisterMIAEmoody szampamoodyz acidMIAE-237MIAE237miae00237
    • 2018-05-11
    141 min

    [MDTM-358]My Very Own Schoolgirl Idol Who Will Let Me Creampie Her Whenever I Want Yuki Kondo

  • yuki kondo censoredcreampieschoolgirlMDTMmedia stationsuginokispace planningMDTM-358MDTM35861mdtm00358
    • 2018-05-11
    119 min

    [VRTM-352]"Daddy, I Really Love You..." When Her Daddy Was Forced To Move Away For Work, She Gave Him A Loving And Tearfull Farewell With Licking, French Kissing Creampie Sex!

  • sakaegawa noa ai minano censoredcreampieschoolgirlVRTMv r producetanakaVRTM-352VRTM352h-910vrtm00352
    • 2018-05-11
    196 min

    [BAZX-134]Sex With A Hard-Working Newly Graduated Business Woman vol. 004

  • censoredcreampieuniformBAZXmedia stationtodobazookaBAZX-134BAZX13461bazx00134
    • 2018-05-10
    243 min

    [NHDTB-122]Hotel Molester 5 - Creampie Special

  • censoredcreampiebig titsNHDTBnatural highitaka smithlin powderNHDTB-122NHDTB1221nhdtb00122
    • 2018-05-10
    132 min

    [SVDVD-661]These Office Ladies And College Girl Babes Are Wearing A Fake Uniform And Pretending To Be Business School Students So We Caught Them And Gave Them Creampie Punishment Rape

  • censoredcreampieSVDVDsadistic villagekamega erectionSVDVD-661SVDVD6611svdvd00661
    • 2018-05-04
    122 min

    [ONEZ-139]Baby Making Sex Videos Featuring Husbands And Wives Who Want A Kid FILE.001 A Department Store Employee Married For One Year Miho (24 Years Old)

  • censoredcreampiemarried womanONEZprestigetodoonezONEZ-139ONEZ139118onez00139
    • 2018-05-04
    117 min

    [ONEZ-137]The Highest Class Oriental Married Woman Rejuvenating Creampie Massage Vol.003 Hikari Anzai

  • anzai hikari censoredcreampiebig titsONEZprestigetodoonezONEZ-137ONEZ137118onez00137
    • 2018-05-03
    140 min

    [DOHI-069]My Sister And Her Friends Were Afraid To Get Caught, So We Quietly Fucked In Shame... We Know It's Wrong, But We Can't Stop Our Lust! Fully Satisfying Creampie Sex And We Absolutely Can't Tell My Little Sister

  • sena ai asada yuri censoredcreampiesquirtingDOHIoffice k sonigara gonzaburoinsertDOHI-069DOHI06936dohi00069
    • 2018-04-28
    68 min

    [ETQR-038]A Beautiful Girl In A Sailor Uniform Will Let You Have Creampie Raw Footage Sex Aya Sazanami

  • censoredcreampieblowjobETQRerotic timeETQR-038ETQR038h-1186etqr00038
    • 2018-04-27
    241 min

    [MDTM-355]Horny Schoolgirl Babes Domesticated Through Creampie Sex 4 Hours

  • censoredcreampieschoolgirlMDTMmedia stationspace planningMDTM-355MDTM35561mdtm00355
    • 2018-04-26
    142 min

    [RCTD-099]The Slutty Girls' School Of Indifference 3

  • shiina sky aya miyazaki censoredcreampieslutRCTDrocketscarecrowRCTD-099RCTD0991rctd00099
    • 2018-04-14
    119 min

    [BLK-362]Little Devil In Uniform Gal Of The Day A Secret Panty Shot Temptation Sex Club Erica Saeki

  • erika kashiwagi censoredcreampieuniformBLKkira kirakira kira black galBLK-362BLK362blk00362
    • 2018-04-14
    146 min

    [MVSD-352]These Two Beautiful Young Girl in Uniform Babes Are Friends Who Take Turns Getting Their Pussies Pumped In Valley To Valley Creampie Sex

  • kuraki bookmark mitsuki kamiya censoredcreampiebeautiful girlMVSDm s video grouptetsuya taniwatariMVSD-352MVSD352mvsd00352
    • 2018-04-13
    209 min

    [SABA-404]A Beautiful Girl With Tiny Tits In A School Uniform Vol.001 She'll Be Having Constant Nipple Tweaking Creampie Sex After School

  • censoredcreampieblowjobSABAclass s amateurtodoSABA-404SABA404h-244saba00404
    • 2018-04-13
    147 min

    [MDTM-351]I Love Going To School On Weekends... Rion Izumi

  • rion izumi censoredcreampieschoolgirlMDTMmedia stationskillful between floorsspace planningMDTM-351MDTM35161mdtm00351



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download