censored creampie hours more best omnibu high visio




FC2FSDSSJULMVSDKSBJDTTHZGDAMBIMARASQTEAVSAHMNGMEMSSNICESDCAWDDASDPREDKBIAUKSNGOD

2020-09-17
60 min

1Pondo 091720_001 Instant BJ: From the glans to the ball bag with cosplay! Mikuro Komori

  • amateur uncensored1pondo
    • 2020-09-21
    58 min

    [tkwa-110]あさみ

  • amateur censoreduniformschoolgirltkwatkwa-110tkwa110tkwa-110
    • 2020-09-22
    53 min

    C0930 ki200922 Yukie Imamura 33years old

  • amateur uncensoredc0930
    • 2020-09-26
    123 min

    [SWDF-005]アソコに直穿きスポウェア女子 マン汁じゅわっと火照ったカラダでエクササイズ！！

  • kimi and ayumi tamaki walnut censoredsquirtingSWDFoyster shippingswordfishSWDF-005SWDF005h-1359swdf00005
    • 2020-09-27
    133 min

    [KNAM-024]Totally Raw Threesome #Love Hotel Creampie #Ami The Neat And Clean Slut With Short Black Hair x Mone The Slutty Ditz

  • censoredcreampieuniformKNAMfirst star100 raw styleKNAM-024KNAM024h-491knam00024
    • 2020-10-11
    118 min

    [USAG-021]Teenage Creampie-chan Loves Sperm - Seeding This Raw Fucking Addict Girl's Young Pussy 3 Times In A Row After Holding It In For A Week

  • censoredcreampieUSAGrabbit daydreamersUSAG-021USAG021usag00021
    • 2020-10-21
    47 min

    [tkwa-125]せいら

  • amateur censoreduniformamateurtkwatkwa-125tkwa125tkwa-125
    • 2020-10-23
    121 min

    [NEM-047]True/Abnormal Sexual Intercourse, Family Fun With A 50-something Mother, Taking A Big Semen Bukkake From Her Rebellious Step-son - Yumiko Sakura

  • yumiko sakura censoredcreampiebig titsNEMglobal media entertainmentjiro sadogashimanewmomNEM-047NEM047143nem00047
    • 2020-10-25
    121 min

    [ANX-128]The Art of Control Seminar LIVE - Performer: Yurika Aoi, Subject: Yurina Aizawa

  • yurika yurina aizawa censoredbig titsANXsaimin kenkyuusho bekkansaimin rei onna saimin kenkyuusho bekkanANX-128ANX128anx00128
    • 2020-11-12
    65 min

    [NYH-052]My Sister's Friend Kept Tempting Me With Pantyshots Under Her Miniskirt, So I Flipped Up Her Skirt And Stuck A Vibrator Up There While She's S******g Next To My Sister. Sana Yotsuba

  • sana yotsuba censoredNYHdirectorsdirectorsnyanjiang houseNYH-052NYH0521nyh00052
    • 2020-11-13
    170 min

    [JUFE-224]Hit On Until She Cheats At The Massage Parlor - Her Masseur's Hands Feel So Good That This College Girl Doesn't Care That Her Boyfriend Is Right There And Cums Hard Karen Otoha

  • karen otoha censoredJUFEfitchJUFE-224JUFE224jufe00224
    • 2020-11-19
    187 min

    [HUNTA-888]"But I Love You! Won't You Go Out With Me？! (Just K*dding)" Total Sluts Will Say Anything To Get Your Dick... Fake Confessions Lead To A Wild Orgy!

  • censoredschoolgirlHUNTAhuntercognac kaminohhh groupHUNTA-888HUNTA888hunta00888
    • 2020-11-22
    16 min

    KSTC-013 Natsuki-san

  • amateur censoredamateurbeautiful girlkstckstc-013kstc013kstc-013
    • 2020-11-29
    71 min

    200GANA-2392 Seriously Nampa, first shot. 1561 A female college student who is worried about the difficulty of remote classes at the university … Actually, are you also worried about ikenai love？ Do you want to radiate your anguished desires, or

  • amateur censoredsquirtingamateurganagana-2392gana2392200gana-2392
    • 2020-12-09
    59 min

    [CSDX-008](4K) Cosplay x Narumi Hirose Narumi Hirose

  • narumi hirose censoredcreampiecosplayCSDXcrystal picturecosdeluxeCSDX-008CSDX00849csdx00008
    • 2020-12-16
    87 min

    300MAAN-609 [Blow God who sucks sperm of Dopyudopyu customers] A newcomer pub lady with sexy beautiful skin is cum swallowing a large amount of sperm (for 2 people)! Blow licking blowjob that sucks and licks vulgarly with a tongue! A slimy intercrura

  • amateur censoredamateurcosplaymaanmaan-609maan609300maan-609
    • 2020-12-20
    118 min

    [CAWD-159]She Knows The Key To A Man's Heart Is Through His Stomach - And Balls! This College Girl Works Part Time As A Maid Who Provides Special Services For Her Clients - This Sub Is Ready For Her Porn Debut! Kurumi Yuina

  • nominal walnut censoredcreampiebeautiful girlCAWDkawaiitiger kosakaiCAWD-159CAWD159cawd00159
    • 2020-12-20
    115 min

    [NNPJ-420]Picking Up Girls To Take Them To Love Hotels... I Scored An Adorable College Girl On A Two-Hour Break Between Classes And Pumped Four Loads Into Her - Casual Hookup (Real Life College S*****t) Himari-chan (20 Years Old)

  • censoredcreampieblowjobNNPJnanpa japanNNPJ-420NNPJ420nnpj00420
    • 2021-01-10
    137 min

    [CESD-965]Young Wife Broken In By Her Naughty Boss's Kisses June Lovejoy

  • june lovejoy censoredmature womansingle workCESDceleb no tomoCESD-965CESD965cesd00965
    • 2021-01-19
    51 min

    FC2PPV 1651850 [New work] Until January 26, 1800pt → 1400pt [Reunion] Gonzo with a 38-year-old neat and clean Pocha wife! I went on a trip and made a vaginal cum shot for the first time ♡ [High image quality]

  • amateur uncensoredfc2
    • 2021-01-29
    45 min

    FC2PPV 1664334 [Personal shooting, with W benefits] Nice ass wife finally contacted, and the sobbing of pleasure that continues to leak into the body that can continue to blame …

  • amateur uncensoredfc2
    • 2021-01-31
    34 min

    493PKPD-082 [Back thing] Drink tattoo gals and seed dangerous days FU ○ K!

  • amateur censoredamateurbeautiful girlpkpdpkpd-082pkpd082493pkpd-082
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-25
    45 min

    Pacopacomama 022521_439 Cream-pie sanctions on shoplifting housewives Nanako Misaki

  • amateur uncensoredpacopacomama
    • 2021-03-05
    122 min

    [ONEZ-276](Complete POV) Loving Sex With My Super Cute Girlfriend At A Hotel Aoi Nakajo

  • nakagusuku censoredcreampieblowjobONEZprestigeonezONEZ-276ONEZ276118onez00276
    • 2021-03-06
    48 min

    FC2PPV 1713662 Active underground idol N ☆ Emergency shooting! 3P continuous vaginal cum shot in the king game ♡ Review privilege is 4K ☆ Virgin Ichikoro sweater … (*’艸 ｀)

  • amateur uncensoredfc2
    • 2021-03-21
    74 min

    490FAN-073 Yuri

  • amateur censoredcreampiebig titsfanfan-073fan073490fan-073
    • 2021-03-27
    60 min

    FC2PPV 1743233 Testicle Massage ＃ 8 Kurumi Aizawa [Tokyo Hands @ Men’s Esthetics]

  • amateur uncensoredfc2
    • 2021-03-31
    18 min

    10musume 033121_01 Secret Pussy Collection: Takako Usami

  • amateur uncensored10musume
    • 2021-04-17
    119 min

    [JUL-550]I Work For A Housecleaning Service, And I Was Sent To The Home Of The Worst Bad Boy In The Neighborhood. Marika Kobayashi

  • marika kobayashi censoredcreampiemature womanJULmadonnaunicorn fukudaJUL-550JUL550jul00550
    • 2021-05-01
    160 min

    [DVDMS-661]A Normal Boys And Girls Focus Group Adult Video These Stepbrothers And Sisters Are Keeping It In The Family And We Followed Up To See What Was Going On In This Special A Kind And Gentle Big Tits Stepsister And Her Cherry Boy Little Stepbro

  • censoredcreampiebig titsDVDMSdeep sfunky hasegawaDVDMS-661DVDMS661dvdms00661
    • 2021-05-07
    119 min

    [MEYD-675]I Went To A Rubber Mat Health Club That Didn't Allow Fucking, And Out Came The Haughty And Naughty Beautiful Married Woman From Next Door. Now That I Knew Her Secret, I Could Get All The Sex And Creampie Fucking I Wanted! And Even Outsi

  • hikari hime censoredcreampiesingle workMEYDtameike goroshiro shotenMEYD-675MEYD675meyd00675
    • 2021-05-11
    129 min

    [KTRA-296]Really Crazy Girl Creampied - Akane Shiki

  • shiki akane censoredcreampiebig titsKTRAk tribeKTRA-296KTRA296
    • 2021-05-20
    136 min

    [HBAD-584]Cumming With An Amazing Titty Fuck Technique From A High-class Call Girl With Big Tits - Saeko Hiiragi

  • hiiragi saeko censoredbig titsblowjobHBADhibinorokutanzo no seishibabeHBAD-584HBAD5841hbad00584
    • 2021-05-22
    60 min

    FC2PPV 1830327 [500PT OFF] G cup idol class JD ＃ 2 Mei-chan has a nightmare of unauthorized vaginal cum shot again w (with review benefits)

  • amateur uncensoredfc2
    • 2021-06-01
    120 min

    [NACR-429]I Was Interested In My Mother-in-law's Breasts Shiori Tsukada

  • shiori tsukada censoredcreampiebig titsNACRplanet plusbito sakurananakuruNACR-429NACR429h-237nacr00429
    • 2021-06-11
    152 min

    [MIFD-163]This Fresh Face, F-cup Quarter Foreign Girl With Beautiful Skin's Sexual Desire Is Just Too Strong, She Refused To Wear The Condom And Got Her AV Debut With Creampie Sex!! Anna

  • censoredcreampiebig titsMIFDmoodyzusa pyonmoodyz freshMIFD-163MIFD163mifd00163
    • 2021-06-20
    239 min

    [OKAX-748]"No... Stop..." Pranks On My Younger Stepsister 240 Minutes

  • censoredsisterOKAXk m producedick mandokuokazuOKAX-748OKAX748okax00748
    • 2021-06-22
    138 min

    FC2PPV 1881246 [19-year-old Influencer Outflow] * Limited Quantity *

  • amateur uncensoredfc2
    • 2021-07-04
    57 min

    413INST-136 [Unprecedented 6P outflow! ] Big areola for big breasts and beautiful breasts! Bitch 3 Beauty vs Big Cock Corps Creampie! Squirting! Continuous Acme Sake Pond Meat Forest Hyper Raw Saddle Orgy

  • amateur censoredcreampiebig titsinstinst-136inst136413inst-136
    • 2021-07-10
    119 min

    [SABA-708]"I'm quitting school because I got knocked up by an old guy..." A story of the pure love between a filthy horny nympho in a school uniform and an old guy's massive cock she was captivated by. G-cup Misa (pseudonymn)

  • censoredcreampiebig titsSABAskyu shirototodoSABA-708SABA708saba00708
    • 2021-07-10
    205 min

    [BAZX-297]S******g One's Way Up the Ladder Through Creampie Raw Footage And Ovulation Day with Your Most Beloved and Favorite Idol vol. 001

  • censoredcreampieuniformBAZXbazookatodoBAZX-297BAZX297bazx00297
    • 2021-07-16
    134 min

    [HZGD-193]Sex In Paradise Lost - Secret Meetings Over And Over, An Intensifying Love...Forbidden Adultery - Kana Morisawa

  • kana morisawa kanako iioka censoredcreampiesingle workHZGDmarried woman flower garden theaterzampaimage married woman flower garden theatHZGD-193HZGD193h-1100hzgd00193
    • 2021-07-23
    125 min

    [KTKC-121]Girl With K-Cup Titties In A Long Dress Shocking Footage Of A Slutty Girl With An Incredible Curvy Body Going Wild In The Park In The Middle Of The Day

  • censoredbig titsamateurKTKCkitixx mousouzokubig titsKTKC-121KTKC121ktkc00121
    • 2021-07-24
    240 min

    [BDSR-455]Married Women's Cowgirls - 36 Horny Wives, 4 Hours

  • yu kawakami morino morino suzukiririka censoredbig titsmarried womanBDSRbig mocalmecates takedaBDSR-455BDSR45557bdsr00455
    • 2021-08-13
    122 min

    [TPPN-202]Teppan! First Appearance! Multiple Handjobs! Semen BUKKAKE! Shower! Shower! Shower! Of Semen! She"ll Slurp Your Semen Until Your Balls Are Empty! The Whore Who Loves Semen. Kaho Imai

  • natsuho imai censoredbig titssingle workTPPNteppanTPPN-202TPPN202tppn00202
    • 2021-08-14
    130 min

    [BBTU-018]Big Boobs Training Class In A Secret Room Yukino Nagisa

  • yukino nagi censoredbig titsschoolgirlBBTUdogmatenunore no boinBBTU-018BBTU018bbtu00018
    • 2021-09-09
    92 min

    240TOKYO-431 Miyu

  • amateur censoredamateurcosplaytokyotokyo-431tokyo431240tokyo-431



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download