censored creampie documentary javcensored high vision




FC2MILKATIDCHRVAUKSSHKDLULUNATRGVHCJODAMBIHODVWANZSQTESTARSMVSDMEYDDASDCESDCAWDMIDV

2020-11-04
68 min

SIRO-4309 [First shot] [Sensitive daughter with little experience] [Healthy young skin] An active female college student who was not satisfied with her premature ejaculation boyfriend. She touched the technique of an adult and experienced the charm o

  • amateur censoredamateursirosiro-4309siro4309siro-4309
    • 2020-11-08
    61 min

    413INST-068 Kozue-chan, 18 years old ☆ “I’ll do my best ♪” Black-haired neat and clean pettan beautiful girl research student who dreams of being a full-fledged idol ☆ Toilet bowl fallen SEX to be vaginal cum shot ♪

  • amateur censoredcreampieamateurinstinst-068inst068413inst-068
    • 2020-11-12
    26 min

    H4610 ki201112 Chiaki Mamiya 20years old

  • amateur uncensoredh4610
    • 2020-12-03
    61 min

    FC2PPV 1593139 300pt OFF for a limited time [No / piece] “… I’ve come to like big ♡♡♡” My lover in my heart !？ After the first date with Nanami who is injured at a marriage party, overwriting SEX that makes me forget my ex-boyfrie

  • amateur uncensoredfc2
    • 2020-12-06
    38 min

    [ZOZO-021]Healthy P.E. At A Coed School 2020 2nd Period A Coed Medical Examination

  • censoredcreampiesquirtingZOZOsadistic villageZOZO-021ZOZO0211zozo00021
    • 2021-01-01
    102 min

    [MBRAA-187]大矢あいみ 制服SCANDAL

  • ooya aimi censoredsoloworkMBRAAspice visualMBRAA-187MBRAA187
    • 2021-01-10
    129 min

    [MOPG-067]I'd Love It If That Girl Was The Kind Of Slut Who'd Choke Me While Teasing My Nipples. Natsuki Kisaragi

  • natsuki kisaragi censoredanalbig titsMOPGm o paradisemo goldMOPG-067MOPG067mopg00067
    • 2021-02-01
    120 min

    [NACR-393]A Son's Wife In Love With Her Father-In-Law Misuzu Kawana

  • misuzu kawana censoredcreampieblowjobNACRplanet plusbito sakurananakuruNACR-393NACR393h-237nacr00393
    • 2021-02-04
    20 min

    Caribbeancom 020421-001 Sexy Celebrity Encyclopedia: Kurumi Kokoro

  • kurumi kokoro uncensoredcaribbeancom
    • 2021-02-06
    151 min

    [SHKD-929]Art Department Teacher Made Into An Artist's Model Minori Hatsune

  • hatsune minori censoredsingle workSHKDattackersbungo maedasharkSHKD-929SHKD929shkd00929
    • 2021-02-06
    52 min

    FC2PPV 1674481 Devil’s Blade-Beautiful young landlady of a certain inn-Participation of the first string [No]

  • amateur uncensoredfc2
    • 2021-02-12
    150 min

    [EBOD-804]My Daughter's Best Friend Seduced Me With The Best Weapon In Her Arsenal (Her Big Tits)... The Secret Age-Gap Creampie I Can Never Tell My Family About Hana Himesaki

  • himesaki hana censoredcreampiebig titsEBODe bodygoemonEBOD-804EBOD804ebod00804
    • 2021-02-20
    99 min

    [YSN-540]This Plain Jane Temporary Worker With Big Tits Is Hooked On Cocks Because She's A Meat-Eating Maso Bitch With A Screw Loose, And Loves To Suck Dick So Much That The Entire Stuff Is Scared Shitless Of This Crazy Cunt (LOL) Chinatsu Asamiy

  • chinatsu asamiya censoredcreampiebig titsYSNnonYSN-540YSN540h-127ysn00540
    • 2021-02-21
    150 min

    [JUL-481]Bridal Massage Parlor NTR - A Slender Wife Who Falls To A Therapist's Indecent Fingertips - Nozomi Higashi

  • nozomi higashi censoredcreampiemature womanJULmadonnaorion chairJUL-481JUL481jul00481
    • 2021-02-28
    150 min

    [DLPN-005]Popular In Her Mommy Group, Bright, Cheerful And Dependable 40-Something Sayuri Has Cute Double Teeth (44)

  • censoredamateurDLPNilka emmanuelDLPN-005DLPN005dlpn00005
    • 2021-03-13
    121 min

    [MUDR-143]My Little Stepsister Is A Cute GAL Real Edition My Little Stepsister Wants To Cuddle. Momo Kato ka

  • kato momoka censoredcreampiesquirtingMUDRmukuMUDR-143MUDR143mudr00143
    • 2021-04-09
    420 min

    GWNTR-001 [Limited time sale] [MGS exclusive distribution BEST] NTR.net Vol.01 17 people 7 hours

  • amateuramateur censoredamateurgwntrgwntr-001gwntr001gwntr-001
    • 2021-04-10
    121 min

    [AUKG-509]

  • sugisaki shizuka nagahara natsuki censoredlesbiandramaAUKGu krentoAUKG-509AUKG509
    • 2021-05-01
    160 min

    [DVDMS-661]A Normal Boys And Girls Focus Group Adult Video These Stepbrothers And Sisters Are Keeping It In The Family And We Followed Up To See What Was Going On In This Special A Kind And Gentle Big Tits Stepsister And Her Cherry Boy Little Stepbro

  • censoredcreampiebig titsDVDMSdeep sfunky hasegawaDVDMS-661DVDMS661dvdms00661
    • 2021-05-05
    133 min

    [GVH-226]Titty Loving Shota-kun's Lewd Prank Nenne Ui

  • first love censoredbig titssingle workGVHglory questtorindoru tanakaGVH-226GVH22613gvh00226
    • 2021-05-19
    19 min

    FC2PPV 1825858 [Same day student] (Leaked) C school student who is squid and trained by men at a spear room hotel exclusively for Yokohama members [Caution to be deleted]

  • amateur uncensoredfc2
    • 2021-06-01
    182 min

    [STARS-371]MINAMO Super Huge, Fresh Face AV DEBUT [Get Off In This Staggering 4K Video!]

  • minamo censoredbeautiful girlsingle workSTARSsod createhideyuki shinboSTARS-371STARS3711stars00371
    • 2021-06-04
    119 min

    [BBAN-328]"But Still...I Don't Love You" Ravished By The Female Coworker I Hate... Hijiri Maihara Yui Hatano

  • kiyoshi maihara yui hatano censoredlesbiandramaBBANbibianBBAN-328BBAN328bban00328
    • 2021-06-11
    65 min

    FC2PPV 1863914 A teenage girl, Shiho-chan with an overwhelming sense of transparency. She called to the hotel after school and finally succeeded in vaginal cum shot.

  • amateur uncensoredfc2
    • 2021-06-16
    119 min

    [PPPD-938]The Spence Gland Development Clinic Nanami Matsumoto

  • nana matsumoto censoredcreampiebig titsPPPDoppaiPPPD-938PPPD938pppd00938
    • 2021-06-19
    154 min

    [JUL-609]Shocking Transfer Madonna Exclusive - Rinka Tahara Will Drench You In Her Faithless Passion For 3 Full Fucks - Special

  • rinka tahara censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-609JUL609jul00609
    • 2021-06-20
    205 min

    [SABA-706]Voyeur Rejuvenation Massage: Real Raw Sex With The Married Masseuse

  • censoredcreampieSABAskyu shirotohasshiSABA-706SABA706saba00706
    • 2021-07-02
    36 min

    FC2PPV 1900335 [Personal shooting, 3P, weekend limited pt off, with W benefits] A 29-year-old married woman with a serious husband and daughter drowning in the pleasure of two blame ②

  • amateur uncensoredfc2
    • 2021-08-29
    69 min

    200GANA-2549 Seriously Nampa, First Shot. 1683 A Junior College Student Who Pretended To Be A Monitor Survey Of A Sweat Wipe Sheet And Brought Him To A Hotel! Beautiful Legs X Nice Ass! Give A Sweet Voice To The Actor’S Sex Estrus On The Fascina

  • amateur censoredamateurganagana-2549gana2549200gana-2549
    • 2021-09-01
    122 min

    435MFC-137 [Erotic Brilliant Orgy Friends] Mechakawa Twins Outfit Duo Boyfriend Exchange Swapping Sex! My Boyfriend’S Friend Also Participated In The War And 5 People Got Mixed Up And 7 Ejaculations Of Raw Squirrel And Turmoil! [Shiroto Gonzo ＃

  • amateur censoredcreampiesquirtingmfcmfc-137mfc137435mfc-137
    • 2021-09-11
    171 min

    [TPIN-011]The Super Sketchy Exhibitionist Method Of Fashion And A Set Of Big Ass And Tits Specialized For Sex Yuka G-Cup Titties

  • censoredcreampieTPINtsubakihoinTPIN-011TPIN011tpin00011
    • 2021-09-16
    87 min

    413INST-162 ● Gravure Warring States Period ● Healing Jcup Gravure Before Debut Private Gonzo Individual Shooting Cosplay Creampie!

  • amateur censoredcreampiebig titsinstinst-162inst162413inst-162
    • 2021-10-16
    81 min

    230OREC-912 Sora (Sora Inoue)

  • amateur censoredcreampieamateurorecorec-912orec912230orec-912
    • 2021-10-20
    124 min

    [GVH-307]Father In Law and Daughter In Law, Close Creampie and Sex. Sakura Tsuji.

  • sakura tsuji censoredcreampiegrandfatherGVHglory questtakahashi chitsujiGVH-307GVH307gvh00307
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-20
    61 min

    1Pondo 112021_001 The Throbbing: My Girlfriend Loves Giving Me a Head Early in the Morning Remi Fuyutsuki

  • amateur uncensored1pondo
    • 2021-12-05
    240 min

    [SCR-285]Female S*****t"s Small Hole Indecent Intercourse Footage 4 Hours

  • censoredcreampieschoolgirlSCRglayzs crimeSCR-285SCR28512scr00285
    • 2021-12-09
    52 min

    229SCUTE-1144 Madoka (23) S-Cute Shyness Etch Of A Fair-Skinned Big Tits Girl (Madoka Shizuki)

  • amateur censoredbig titsamateurscutescute-1144scute1144229scute-1144
    • 2021-12-11
    239 min

    [CADV-834]The Girl Of My Dreams, Nanami Matsumoto

  • nana matsumoto censoredcreampiesingle workCADVcrystal eizoucrystal exCADV-834CADV834cadv00834
    • 2021-12-25
    143 min

    [LZDM-046]Big Tits Of Straight Man Go Crazy With Amazing Technique, Lesbian Fallen Portio Esthetic Sachiko, Nanako Miyamura

  • sachiko nanako miyamura censoredbig titslesbianLZDMlesreultimate ryolezure dramaLZDM-046LZDM046lzdm00046
    • 2022-01-07
    54 min

    FC2PPV 2577318 ★ 3p Orgy Continuous Vaginal Cum Shot ★ [No] Blow Master Yuuki And Two Cocks Erected ♥ Nuru Nuru Oil Play ♡ Dirty G Cup Is Shaken Violently And Semen Is Injected Deep Into The Vagina ♥ * Bonus: Handjob & Blow In The Bath Video Witho

  • amateur uncensoredfc2
    • 2022-01-07
    118 min

    [SSIS-292]Madonna (Beauty) Who Used to Bully Me is Now a Rich Celebrity"s Wife...After I Witnessed Her Having an Affair, I Could Fuck Her As Much As I Wanted. Marin Hinata

  • marin hinata censoredbig titssquirtingSSISs1 no 1 styletiger kosakaiSSIS-292SSIS292ssis00292
    • 2022-01-07
    145 min

    [JUL-823]69 On A Summer Day Dripping With Sweat - Six Nines - Passionate Intercourse Obscene Middle-aged Copulation Seen In Overhead Video Ririko Kinoshita

  • kinoshita rinko censoredbig titsmature womanJULmadonnahiroyuki kimuraJUL-823JUL823jul00823
    • 2022-01-14
    120 min

    [PPPD-996]Detestable Boss Fondles Her Sexy Tits During Overtime For The Perfect Workplace Harassment. Female Employee Gets Her Sensitive Colossal Tits Worked Over For Pleasure. Hitomi

  • hitomi censoredcreampiebig titsPPPDoppaiPPPD-996PPPD996pppd00996
    • 2022-01-21
    35 min

    FC2PPV 2608344 First Shot! !! Limited Number! [Uncensored] Aquarium Date With My Ex-Student Who Goes To Art School … Creampie Twice In The White Body Of A 21-Year-Old Active Art School Student Who Trembles Inexperienced! !! (Feature Film)

  • amateur uncensoredfc2
    • 2022-02-17
    126 min

    [FANH-071]Slime I-Cup Huge Tits Married Woman Akira-san Nasty Wife Cheats And Films Herself With Multiple Younger S*****t Fuck-Buddies Masturbation Triple Penetration

  • censoredcreampiebig titsFANHhamedori.network secondeditionFANH-071FANH071h-1472fanh00071
    • 2022-02-25
    148 min

    [DFE-059]A Middle-Aged Cherry Boy If I Could Be Reborn ... I Would Like To Be Born Again As A Cherry Boy. Chiharu Miyazawa

  • chiharu miyazawa censoredbeautiful girlsingle workDFEwaap entertainmentham the mcfearlessDFE-059DFE0592dfe00059
    • 2022-03-04
    120 min

    [IPX-835]Crazy Room Sharing Scenario At A Hot Springs Inn During A Business Trip With An Utterly Despicable Boss... He"s An Ugly And Vigorous Older Guy That Gives Me Orgasms Over And Over Again Until Giving Me A Creampie Load. Yume Nishimiya

  • yume nishinomiya censoredcreampiebeautiful girlIPXidea pocketdishIPX-835IPX835ipx00835



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download