censored beautiful tits big.compilation jav




FC2AMBIHUNTBSQTEVEMAMIAASANDASDSHKDAWDCESDAUKSKSBJAPODMEYDHDKAVENXWAAACJODGVHBBAN

2020-10-04
106 min

[VEC-444]My Mom's Friend Mako Oda

  • oda mako censoredcreampiebig titsVECvenuskaniemegami venusVEC-444VEC444vec00444
    • 2020-10-04
    128 min

    [DNJR-036]This Is Our Daily Life Together A Lovey-Dovey Sex Life Between A Sadistic Girlfriend And Her Maso Boyfriend Urara Uraraka

  • beautiful censoredbig titsslutDNJRdog daydreamersmeat and piss house prime cutDNJR-036DNJR036dnjr00036
    • 2020-10-06
    136 min

    [SDDE-633]- A Beauty Salon Where Sex Is Part Of The Service - "Continous Intercourse" Estethician

  • yoshioka asuka ayano kato censoredcreampiesquirtingSDDEsod createsiberia sakaisenzSDDE-633SDDE6331sdde00633
    • 2020-10-08
    47 min

    [gerk-309]Oさん

  • amateur censoredcreampiebig titsgerkgerk-309gerk309gerk-309
    • 2020-10-31
    145 min

    [MIDE-844]My Favorite Pop Star Betrayed Me, So I Gave Her What Was Coming To Her: My Cock -Super Fan Gone Bad Films His Revenge Sex- Sora Minamino

  • minano sora censoredbeautiful girlsingle workMIDEmoodyzoosaki hirokoujimoodyz divaMIDE-844MIDE844mide00844
    • 2020-11-27
    241 min

    [HGOT-062]The Moment When Girls Let Their Secret Desires Loose!! Popular Actresses' Hot And Steamy Situation SEX, 4 Hours

  • manami oura yui nagase censoredcreampiebeautiful girlHGOTlemon matsubaraHGOT-062HGOT062h-1414hgot00062
    • 2020-11-30
    42 min

    [ore-724]すずか

  • amateur censoredcreampieamateuroreore-724ore724ore-724
    • 2020-12-02
    71 min

    FC2PPV 1591233 First shot ❤️ Superb idol class innocent young lady! Fair-skinned slender little ❤️ ~ Add plenty of sperm to a neat face ~ [Personal shooting]

  • amateur uncensoredfc2
    • 2020-12-10
    93 min

    [OKS-101]The Best Tight, Wet, Glistening School Swimsuits: Arisu Otsu - D***k Your Fill Of Cute Girls In Swimsuits! Starting With Voyeur Footage Of Them Getting Changed, Then On To Small Tits, Big Tits, Shaved Pussies, Hair Sticking Out, Hairy Armpit

  • otsu alice censoredbeautiful girlbukkakeOKSpersonal photography of fathergod school waterOKS-101OKS1011oks00101
    • 2020-12-12
    152 min

    [DASD-779]The Only Way This Faithful Stepdaughter Can Atone For Her Stepdad's Crimes. Nene Tanaka

  • nene tanaka censoredcreampiebig titsDASDdashiromichi hoseDASD-779DASD779dasd00779
    • 2020-12-22
    38 min

    [tkwa-143]ひまり

  • amateur censoredschoolgirlamateurtkwatkwa-143tkwa143tkwa-143
    • 2020-12-25
    479 min

    [MBM-255]"That's Not Why I Came Here" At Least, That's What She Said, But... He Had A Macho Physique, Unlike Her Older Husband, And He Took Her Home For A Creampie Wife Swap 36 Super Select Beautiful Married Woman Babes 8-Hour Special

  • censoredcreampiemature womanMBMprestigembmMBM-255MBM255118mbm00255
    • 2021-01-06
    65 min

    Pacopacomama 010621_414 Mayumi Sakanishi

  • amateur uncensoredcreampieblowjobpacopacomama
    • 2021-01-09
    180 min

    [MIFD-144]Fresh Face! At Age 20 She's Finally Allowed Out Late At Night So She's Decided To Star In Porn! Wealthy College Girl Ready To Wild - Her Porn Debut! Mone Kono

  • mone kamishiraishi censoredbeautiful girlsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-144MIFD144mifd00144
    • 2021-01-13
    59 min

    SIRO-4394 [First shot] [Cool beauty faints in agony] [Fluffy boobs] The swaying boobs are easy to feel and are in agony with a violent piston. Cool girlfriend desperately trying to entertain a big cock .. AV application on the net → AV experience sho

  • amateur censoredamateursirosiro-4394siro4394siro-4394
    • 2021-01-21
    120 min

    [FSDSS-157]Sweet Dirty Talk In A Lovey-Dovey-Hold - Ena Satsuki

  • ena satsuki censoredschoolgirlbeautiful girlFSDSSfalenoflagmanfaleno starFSDSS-157FSDSS1571fsdss00157
    • 2021-01-22
    46 min

    [oretd-839]NAGASE

  • amateur censoredcreampieuniformoretdoretd-839oretd839oretd-839
    • 2021-02-05
    131 min

    [HODV-21549]Pleasure Syndrome Case 6: "A Baby-faced Masochistic Woman Who Keeps Crying As She Cums Over And Over Again" - Chiharu Miyazawa

  • chiharu miyazawa censoreddeepthroatsingle workHODVh m pHODV-21549HODV215495642hodv21549
    • 2021-02-17
    130 min

    [GVH-197]Big Tits Servant - Yume Natsuki/Sakura Tsukishima

  • natsuki yume tsukishima sakura censoredslutdeepthroatGVHglorythin bladeGVH-197GVH19713gvh00197
    • 2021-02-25
    160 min

    [MILK-103]Ami Kasai, Complete Combustion. I Am Retiring From Being An AV Actress.

  • kami ami censoredbig titssingle workMILKmilkMILK-103MILK103h-1240milk00103
    • 2021-03-12
    70 min

    FC2PPV 1723045 051 [Massive facial cumshots on a beautiful wife] There is only one thing to do for a married woman to make small changes

  • amateur uncensoredfc2
    • 2021-03-23
    89 min

    261ARA-483 [Naughty cook] 22 years old [Future master] Yuko-chan is here! The reason for her application as a kitchen apprentice at a Western restaurant is "I like sex but I can’t do it alone …" I’m too busy to play or have a b

  • amateur censoredamateuraraara-483ara483261ara-483
    • 2021-03-31
    94 min

    348NTR-029 [Creampie breaking news! ] Big breasts I cup! I fell asleep on a diamond rough girl www I was dazzled by a poor entertainer boyfriend who was dazzled by money I made a vaginal cum shot secretly www It seemed like I was crying, but w but I

  • amateur censoredcreampiebig titsntrntr-029ntr029348ntr-029
    • 2021-03-31
    45 min

    292MY-446 Natsuki Nakano 2

  • amateur censoredcreampiemarried womanmymy-446my446292my-446
    • 2021-04-02
    125 min

    [ARM-967]This Sexy Maid Will Help Her Master With His Masturbation.

  • misaki azusa mamiya nagi censoredanalARMaroma planningmania satoshiaromaARM-967ARM967arm00967
    • 2021-04-11
    70 min

    FC2PPV 1764780 [Personal shooting] ♀307 Female college student Hina ◯ -chan 19 years old 1st shot! A fair-skinned busty G-cup lady JD makes her AV debut on a transcendental danger day with a genuine vaginal cum shot!

  • amateur uncensoredfc2
    • 2021-04-13
    140 min

    [STARS-349]Stimulating Her Uterus With A Big Dick Head Mei Miyajima

  • mei miyajima censoredbig titssquirtingSTARSsod createkaorusod starSTARS-349STARS3491stars00349
    • 2021-04-14
    479 min

    [HHF-011]Sexy Love Chain From Bottom To Top! Energetic Bunk Bed Sex Moving Up And Down Highlights

  • censoredsisterHHFhunterhhh groupHHF-011HHF011hhf00011
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    100 min

    390JAC-090 [Extremely erotic soft body BODY x huge breasts I cup x raw squirrel 4 barrage] Wow Wow Wow Fu-Fu- ♪ Big Pyrevolution 21! Squirting ~ Creampie ~ The uterus I’ve seen all! I cup-too big-everyone is a big pie revolution! !! (Whit) "

  • amateur censoredcreampiebig titsjacjac-090jac090390jac-090
    • 2021-05-14
    38 min

    285ENDX-345 A Female College Student Who Proved The Theory That Science Girls Like SEX! I love feeling good!

  • amateur censoredcreampiebig titsendxendx-345endx345285endx-345
    • 2021-05-22
    65 min

    Pacopacomama 052221_480 Buy Your Underwear: Pussy slip t-back Junko Kunida

  • amateur uncensoredpacopacomama
    • 2021-05-22
    175 min

    [DGCEMD-012]*Delivery Only! Bonus Video Included *First Lesbians Unleashed! When Aya Shiomi Got Some Hard Lesbian Training From Rena Aoi

  • aya shiomi blue censoredlesbianmature womanDGCEMDcelebrity friendsDGCEMD-012DGCEMD012dgcemd00012
    • 2021-05-23
    62 min

    FC2PPV 1832686 Brass band club. 140 cm loli ● K. An unimaginable life of a friendly girl.

  • amateur uncensoredfc2
    • 2021-06-01
    62 min

    FC2PPV 1847366 ★ First shot amateur ☆ Sensual BODY’s bitch beautiful wife ♥ Maki 32 years old ☆ Yariman beauty BODY with electric massage machine ♥ Thirty blowjob ♥ Gun thrusting squirrel in agony ♥ [Individual shooting] Benefits

  • amateur uncensoredfc2
    • 2021-06-15
    64 min

    FC2PPV 1869705 [No] [High-quality review privilege] Until the essence is exhausted ♡ One-on-one 1-hour endurance vaginal cum shot SEX game‼ Break through the limit of 6 consecutive shots! ‼ ‼

  • amateur uncensoredfc2
    • 2021-07-30
    147 min

    [ROE-004]再婚する母へ…嫉妬した僕の止まらない中出し近親相姦 Icup爆乳美魔女、MONROE専属移籍！！ 市川京子

  • kyoko ichikawa censoredcreampiebig titsROEmadonnaunicorn fukudamonroeROE-004ROE004roe00004
    • 2021-07-30
    85 min

    483SGK-035 "Unrivaled Ji ● Po Love" "Innocent Girl In The Country" "Gutchori Wet Wet Constitution" "Ecchi For The First Time In A Year" "Super Do M Ichayo Climax" A Country Girl Working At A Factory From T

  • amateur censoredamateursgksgk-035sgk035483sgk-035
    • 2021-08-07
    74 min

    FC2PPV 1971539 [Personal Shooting] 67th Shooting Kanon 18 Years Old Is A Sober Child With Bristles! Dirty Words Barrage Sure Satisfaction! Life’S First Tokuno Fishy Odor Semen Cum Shot In The Horny Vagina Uterus Hidden Behind The Horny Hair [Tor

  • amateur uncensoredfc2
    • 2021-08-13
    150 min

    [BLK-514]You"ll Enjoy Our Nipple-Licking Handjob Services ... They"ll Seriously Blow Your Mind! This Slender Gal With Long Legs Always Wanted To Be A Slut, And Now She"s Making Her Adult Video Debut Miyu Ouka

  • miyu sakuraka censoredsquirtingslutBLKkira kirazampakira hosi kira black galBLK-514BLK514blk00514
    • 2021-08-30
    48 min

    498DDH-031 Nuruteka X Chewy Super Adhesive Oil Massage Is A Super Erotic Hospitality Technique That Will Exhaust You! Overcapacity Sperm Overflows From The Vagina With 3 Consecutive Vaginal Cum Shot!

  • amateur censoredcreampiebig titsddhddh-031ddh031498ddh-031
    • 2021-09-01
    69 min

    FC2PPV 2118325 [Limited To This Summer] Virgin Real Middle-Aged Tag. You Can Do Anything If You Catch It ~ Summer Memories ~ * Drone Shooting

  • amateur uncensoredfc2
    • 2021-09-10
    118 min

    [JUL-700]Her Teacher Used To Shame Her When She Was A S*****t, And Now, She Met Him Again, When She Discovered That He Was A Customer Of Her Delivery Health Call Girl Services ... And Ever Since That Day, She Became His Obedient Pet And Satisfied His

  • jinguji temple nao censoredcreampiebig titsJULmadonnashiro shotenJUL-700JUL700jul00700
    • 2021-09-11
    58 min

    H4610 ori1764 Rena Ito 22years old

  • amateur uncensoredh4610
    • 2021-09-30
    64 min

    FCP-044 [Distribution Only] "What Did You Do？ You Can Not Sleep？ I’ll Do Something Comfortable And Let You Lie Down … ”Ultimate Healing Erotic! Co-Sleeping Handjob! !! ＃ 4 (Erika Ohara, Saeko Hiiragi, Sari Kosaka)

  • amateur censoredamateurbeautiful girlfcpfcp-044fcp044fcp-044
    • 2021-10-01
    61 min

    478LOLI-035 Uncle Loves Amaenbo Schoolgirl Yumi-Chan Embarrassed Pissing In The Bath (Yui Natsuhara)

  • amateur censoredcreampieuniformloliloli-035loli035478loli-035
    • 2021-10-15
    153 min

    [EBOD-861]A Fresh Face She Deliberated For 623 Days Over Whether To Star In An Adult Video ... And She Finally Decided, I Want To Be An Actress! Her Dreams And Her Titties Are Huge A Doe-Eyed College Girl With Light Skin Makes Her Adult Video Debut S

  • shirasaki satsuka censoredbig titssingle workEBODe bodykyouseiEBOD-861EBOD861ebod00861
    • 2021-10-19
    58 min

    Caribbeancom 101921-001 Luxury Adult Healing Spa: There Is Nothing Better Than Slow Passionate Sex Yuna Sasaki

  • yuna sasaki uncensoredcreampiecaribbeancom



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download