censored beautiful girl jav javcensored




FC2DASDNACRDASDMVSDAUKSNACXSHKDDTTBLKGVHNATRAWDSANAVSAMARACESDPPPDVENUSDABJUL

2024-02-17
106 min

SQTE-524 A Beautiful Girl Who Wants To Do Her Best! G Cup Big Breasts Heal Your Mind And Body And Have Sex Mei Itsukaichi

  • itsukaichi mei censoredbig titsblowjobSQTEs cuteSQTE-524SQTE524sqte00524
    • 2024-02-17
    58 min

    CRNX-101 [4K] I Was Made To Cum So Much That I Wanted To Cry By My Master Who Only Felt Disgust... Konatsu Kashiwagi

  • kashiwagi konatsu censoredcreampiebig titsCRNXcrystal picturecrystal nextCRNX-101CRNX101crnx00101
    • 2024-02-17
    45 min

    229SCUTE-1435 Riku (21) S-Cute Sticking Out Your Tongue Is A Sign That You Are Feeling It

  • amateur censoredamateurbeautiful girlscutescute-1435scute1435229scute-1435
    • 2024-02-17
    41 min

    229SCUTE-1433 Mei (22) S-Cute Nikkan Purun! Big Boobs And Round Ass H

  • amateur censoredcreampiebig titsscutescute-1433scute1433229scute-1433
    • 2024-02-17
    155 min

    TANF-015 Dandelion☆Presents! A Story About Having Sex With A Cool High School Girl Who Came From The Countryside To Tokyo On A School Trip.Chibitori♂&Ran♀ Edition

  • censoredschoolgirlamateurTANFdandelion mousouzokuwowTANF-015TANF015tanf00015
    • 2024-02-17
    117 min

    KSJK-021 Obedience And Dedication Sex With A Plain Student Who Said To Me As A Teacher, ``I Like You. I Want To Have Sex."" Ka Kotone

  • kotoneka censoreduniformschoolgirlKSJKdogmakomatsu seventeenKSJK-021KSJK021ksjk00021
    • 2024-02-16
    120 min

    HMN-524 My Plan To Go To A Riverside BBQ With My Juniors At Work, Two Boys And Two Girls, Was Canceled The Day Before, So I Decided To Go With The Girl From My Part-time Job.Once We Did It, We Got Too Excited, So We Ended Up Staying The Night Until M

  • yuuri censoredcreampiebeautiful girlHMNbooksukezaneheitaHMN-524HMN524hmn00524
    • 2024-02-16
    120 min

    MIAB-110 Every Day, I Peeked At My Older Brother Who Was Being Taught Kissing By A Female College Student Tutor And Was Steadily Improving...I (my Younger Sister) Also Started Kissing...Hikaru Minazuki

  • hikaru minazuki ayame miyakozaki censoredschoolgirlbeautiful girlMIABmoody ssapporo taroeveryone s kikatanMIAB-110MIAB110miab00110
    • 2024-02-16
    120 min

    MVSD-591 I Lost My Mind Due To Her Innocent Smile And Devilish Seduction... A Beautiful Trainer Who Seduces A Middle-aged Man With Her Skillful Slutty Techniques And Naughty Waist Movements - Reverse NTR - Akari Neo

  • akari neo censoredcreampiebeautiful girlMVSDm s video groupasagiriMVSD-591MVSD591mvsd00591
    • 2024-02-16
    150 min

    EYAN-199 When She Worked At Men-S While Her Husband Was Working, She Became A Popular Girl Who Couldn"t Get Reservations. A Beautiful And Lucky Wife Who Can Only Be Seen On Weekdays. AV Debut Mai Koion

  • mai koine censoredbig titshandjobEYANe bodyusapyonhanazakari wivesEYAN-199EYAN199eyan00199
    • 2024-02-16
    120 min

    KAM-173 “Someone...someone Please Help Me...” A Voiceless Scream! I Can"t Even Moan And Suppress My Voice... Beautiful Girl In A Sensitive Uniform Gets Creampied Inside The Library 3 Rei Misumi

  • misumi rei censoredcreampiebeautiful girlKAMkarmagroupKAM-173KAM173kam00173
    • 2024-02-16
    150 min

    MVSD-592 Asshole Service Maid 3 Hole Cum Swallowing Training Fuck! Pussy! Nodomako! Asshole! 30 Consecutive Semen Cumshots In All Masochist Holes! Kozue Minami

  • minami kozue censoredcreampiebeautiful girlMVSDm s video groupMVSD-592MVSD592mvsd00592
    • 2024-02-16
    160 min

    JUFE-552 Beautiful Slut Controlling Dirty Talk With An Absolute Top-down View. Ultimate Subjective JOI Where Ejaculation Is Controlled Mitsuki Nagisa

  • scooping censoredbeautiful girlslutJUFEfitchyumeno aidaJUFE-552JUFE552jufe00552
    • 2024-02-16
    120 min

    MIDV-633 Too Fleeting, Tears... "Can I Become An AV Actress Too？" A Boxed Girl"s AV Debut Who Applied To Change Herself Ayunoka Mori

  • honoka mori censoredbeautiful girlMIDVmoody susapyonmoodyz divaMIDV-633MIDV633midv00633
    • 2024-02-16
    160 min

    HMN-527 An Old Man Who Was A Train Molester When He Was A Student Remarries His Mother. From That Day On, Day After Day, I Was Made To Do My Bidding And Make Her My Pet Inside My Uniform... Hibino Uta

  • kyono uta censoredcreampiesquirtingHMNbookjacken kodamaHMN-527HMN527hmn00527
    • 2024-02-16
    137 min

    702NOSKN-076 20 Year Old H Cup Pink Areola! 1 Night Of Raw Sex And Creampie With The Overwhelmingly Big Breasted Peach Butt Beautiful Girl Suzu Aiho @ Northkins! [Creampie Document]

  • aihosuzu censoredcreampiebig titsnosknnoskn-076noskn076702noskn-076
    • 2024-02-16
    120 min

    MVSD-589 Day After Day When I Come To My Mother"s Father, My Nipples Are Toyed With And Developed, And I Have Learned How To Orgasm From Them. Hibino Uta

  • kyono uta censoredcreampieschoolgirlMVSDm s video groupMVSD-589MVSD589mvsd00589
    • 2024-02-16
    100 min

    MUDR-250 Water Honey Girl 1 & 2 A Boring Middle-aged Teacher With Creepy Glasses Sleep-rapes A Beautiful Girl With Big Breasts In A Uniform. Konatsu Kashiwagi

  • kashiwagi konatsu censoredcreampiebig titsMUDRinnocentMUDR-250MUDR250mudr00250
    • 2024-02-16
    120 min

    MIDV-656 She Gets Excited By Her Older Sister Who Seduces Her Without A Bra And Turns Into A Sexual Monster! Even After Using Up One Box Of Condoms, Sakura Miura Continued To Fuck Even More.

  • minamata sakura otowa misuzu censoredbig titsbeautiful girlMIDVmoody swakatsukimoodyz divaMIDV-656MIDV656midv00656
    • 2024-02-16
    70 min

    534CRT-041 Wearing For 18 Hours [Personal Shooting] A Young Girl In Blue-purple Pants Who Wants To Enjoy The Thrill _ Creampie In The Tiny Pussy Of A Beautiful Black-haired Girl With Bangs

  • amateur censoredcreampieuniformcrtcrt-041crt041534crt-041
    • 2024-02-16
    42 min

    393OTIM-352 AZUKI Has Crazy Sex With A Girl In Uniform From Memories

  • amateur censoredcreampieuniformotimotim-352otim352393otim-352
    • 2024-02-16
    39 min

    393OTIM-342 Job Hunting FILE Sana (pseudonym)

  • amateur censoredcreampiebig titsotimotim-342otim342393otim-342
    • 2024-02-16
    69 min

    MAAN-953 [Tall Gal With Beautiful Legs] Over 500 Experienced People (100 Girls)! ! A Dual-wielding Hostess Who Loves SEX And Has Both Dicks And Pussies Cool! ! A Super Carnivorous Bisexual Who Usually Secures His Prey With Reverse Nan! Chupachupa Wit

  • amateur censoredamateurmaanmaan-953maan953maan-953
    • 2024-02-16
    120 min

    MIDV-631 I"m Going To Make You Understand The Active Girl Who Doesn"t Have Any Desire To Deal With Salt! An Unparalleled Old Man"s Creampie Rape That Overflows With Sperm. Nana Misaki

  • misaki nana censoredcreampieuniformMIDVmoody shiroharu osakimoodyz divaMIDV-631MIDV631midv00631
    • 2024-02-16
    140 min

    MUDR-249 Ever Since That Day... Beautiful Girl In Uniform Gets Creampied During Bondage Training Kozue Fujita

  • kozue fujita censoredcreampieschoolgirlMUDRinnocentMUDR-249MUDR249mudr00249
    • 2024-02-16
    120 min

    MIDV-611 Power Outage Door Lock Confinement, Estrus Sexual Harassment At A Convenience Store In The Middle Of The Night, Store Manager"s Runaway Sex, Slow And Slow Piston Frantic Acme, Rena Miyashita

  • miyashita rena censoredschoolgirlblowjobMIDVmoody scaptain gangwonmoodyz divaMIDV-611MIDV611midv00611
    • 2024-02-16
    40 min

    393OTIM-351 Sex That Drives You Crazy With A Girl In Uniform From Memories MIU

  • amateur censoredcreampieuniformotimotim-351otim351393otim-351
    • 2024-02-16
    36 min

    393OTIM-353 NAKO Has Sex With A Memorable Girl In Uniform That Drives Her Crazy

  • amateur censoredcreampieuniformotimotim-353otim353393otim-353
    • 2024-02-16
    180 min

    FPRE-018 Newcomer, Former Local Station Hcup Weather Girl Mio Yukihira AV Debut! The Beautiful Body Of A Young Lady Ejaculates In The First Shoot

  • yukihira mio censoredbig titssquirtingFPREfitchkyouseipreciousFPRE-018FPRE018fpre00018
    • 2024-02-16
    240 min

    MIDV-627 If You Resist Ejaculation Once An Hour With Ibukin"s Smiling God Service Technique, You Will Be Creampied Raw! A Heart-pounding Overnight Hot Spring Trip Where You Can Go Home Immediately If Something Goes Wrong In Amateur Fan Thanksgivi

  • aoi ibuki censoredcreampiebig titsMIDVmoody szampamoodyz divaMIDV-627MIDV627midv00627
    • 2024-02-16
    120 min

    MIDV-624 "Hey, Who Were You On The Line With？" Jealous Girlfriend Mia"s Jealous Love. Living Together With A Super Slut Who Keeps Having Her Sperm Blown Out With Her Dirty Talk. Mia Nanasawa

  • nanasawa mia censoredbeautiful girlslutMIDVmoody ssapporo taromoodyz divaMIDV-624MIDV624midv00624
    • 2024-02-16
    74 min

    700TLDC-006 "IKASE Howto" Sexy Actor"s Practical Techniques Vs. Hikage Hinata!

  • hinatahikage censoredamateurbeautiful girltldctldc-006tldc006700tldc-006
    • 2024-02-16
    42 min

    393OTIM-354 Vulgar Flattery, Flattery, Impregnation Plea, Child-making OK Service Maid AI

  • amateur censoredcreampieamateurotimotim-354otim354393otim-354
    • 2024-02-16
    40 min

    393OTIM-345 Job Hunting FILE Aoi-san (pseudonym)

  • amateur censoredcreampieamateurotimotim-345otim345393otim-345
    • 2024-02-16
    127 min

    MXGS-1323 Marshmallow H Cup Busty Beauty Gets Addicted To The Sensual Slippery Climax Oil Massage Anna Hanayagi

  • hanayanagi anna censoredcreampiebig titsMXGSmaxingMXGS-1323MXGS1323h-068mxgs01323
    • 2024-02-16
    72 min

    534POK-061 Face Showing [Personal Shooting] A Cut-out Video With A Subculture-type Masturbation ◯ Please Enjoy The Way Her Cool-looking Expression Becomes Erotically Distorted.

  • amateur censoredcreampieuniformpokpok-061pok061534pok-061
    • 2024-02-16
    39 min

    393OTIM-346 Job Hunting FILE Yua-san (pseudonym)

  • amateur censoredcreampiesquirtingotimotim-346otim346393otim-346
    • 2024-02-16
    150 min

    MIFD-470 The Usually Serious And Quiet Florist Takes Off Her Clothes... And Makes Her AV Debut Wearing Micro-manju Breasts For The First Time! Maya Minamimoto

  • maya minamimoto censoredblowjobbeautiful girlMIFDmoody smamezawa mametaromoodyz freshMIFD-470MIFD470mifd00470
    • 2024-02-16
    210 min

    PPPE-190 Returning To Okinawa From Tokyo With Sanshin! Hcup Big Breasted Islander Makes A Triumphant Return On The 3rd Anniversary Of Her AV Debut! Karen Yuzuriha

  • karen kaede censoredcreampiebig titsPPPEoppaiPPPE-190PPPE190pppe00190
    • 2024-02-16
    190 min

    MUCD-296 Lovely Sex With A Super Cute Beautiful Girl In Uniform Who Can Cum At The Best. Super Intense Insemination With Two Beautiful Girls Who Fuck Until All The Sperm Comes Out. Massive Creampie, Gonzo, Blow Job Face And Orgasm Face Are The Best (

  • aizuki himari walnut sakura censoredcreampieschoolgirlMUCDinnocentMUCD-296MUCD296mucd00296
    • 2024-02-16
    50 min

    393OTIM-357 Vulgar Flattery, Flattery, Impregnation Plea, Service Maid KANNA Who Is OK With Having Children

  • amateur censoredcreampieamateurotimotim-357otim357393otim-357
    • 2024-02-15
    83 min

    KAMEF-069 Specializing In Individual Photography Big Breasted Idol Photo Session Ai-chan (19) Machida Lens"s BLACK KAMEKO FILE.69 An Idol Who Knows Nothing Participates In An Obscene Photo Session Like A Part-time Job. Her Breasts Are Photographe

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-069KAMEF069h-1350kamef00069
    • 2024-02-15
    113 min

    HMRK-001 [Golden Ratio Erotic Body Healing Beauty] Although She Is Neat, She Likes Perverted Play! The Smile, The Blowjob Face, And The Orgasm Face Are All Cool! A Naughty And Beautiful College Girl With Beautiful Breasts And A Lovey-dovey Sex Video

  • miyanishi hikaru censoredcreampiebig titsHMRKdochameroku channelHMRK-001HMRK001h-1711hmrk00001
    • 2024-02-15
    59 min

    ddh-244 Treetop

  • amateur censoredcreampieamateurddhddh-244ddh244ddh-244
    • 2024-02-15
    92 min

    UINAV-002 [Bakki Baki Erotic Body] Mechashi Cosplay Slender Beautiful Breasts Muscle Training Girl Tipsy Muscle Protein Creampie On Cheat Day! ! [Chest Constriction Butt]

  • censoredcreampieUINAVhmn workshamedori.network secondeditionUINAV-002UINAV002h-1472uinav00002
    • 2024-02-15
    84 min

    simm-873 Nana(18)

  • amateur censoredcreampieuniformsimmsimm-873simm873simm-873
    • 2024-02-15
    57 min

    739BYKM-015 Mina

  • amateur censoredcreampiebig titsbykmbykm-015bykm015739bykm-015
    • 2024-02-15
    147 min

    MTALL-104 A Young Figure Skater Who Is Indifferent To Sex Becomes Addicted To Pleasure With A Special Reinforcement Coach"s Relentless Massage. 5 Days Of Training With Erect Nipples Shion Chibana

  • chibana shion censoredbeautiful girlsingle workMTALLmateriallhide monkMTALL-104MTALL1041mtall00104



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download