broccoli delusion group




FC2MILKATIDDASDHNDSANMIAANATRAVSACAWDIPXSHKDKSBJDTTNACXAUKSAMBIBBANWAAAROYDNNPJ

2020-10-24
113 min

[DLIS-026]寝取られた女子大生の彼女 柳井める

  • me yanai censoredDLISsharkdirector odelicious timeDLIS-026DLIS026h-687dlis00026
    • 2020-11-06
    29 min

    302GERK-328 Koko

  • amateur censoredcreampieamateurgerkgerk-328gerk328gerk-328
    • 2020-11-06
    229 min

    [HUNTA-886]After We Missed Our Last Train Home, I Spent The Night At My Co-Worker's Place. We Had A Farewell Party And When It Ended, Realizing That I Would Not Be Seeing Her At Work Tomorrow, I Could No Longer Resist, And Started To Seduce Her.

  • censoredcreampieHUNTAhunterspace nyanjirohhh groupHUNTA-886HUNTA886hunta00886
    • 2020-11-07
    69 min

    FC2PPV 1560727 It is made to ejaculate 5 times in 1 hour and it is empty! I couldn’t put up with the hell and I was made to clean my sperm that I had vaginal cum shot with my mouth and continued to ejaculate …

  • amateur uncensoredfc2
    • 2020-11-11
    37 min

    279UTSU-470 Momoka

  • amateur censoredcreampiemarried womanutsuutsu-470utsu470279utsu-470
    • 2020-11-13
    165 min

    [JUFE-225]Sugar Daddy Shop Employee Ranka - Breaking In Her Tanned Supple Flesh With Wild Sex

  • censoredcreampiebig titsJUFEfitchJUFE-225JUFE225jufe00225
    • 2020-11-13
    180 min

    [SQIS-036]Fallen Into Pleasure Hell

  • censoredmarried womandramaSQISfa proSQIS-036SQIS036sqis00036
    • 2020-11-26
    102 min

    [SPRD-1350]Shameful Creampie With My Stepmom A Stepmom Who Got Creampie Fucked For The First Time By Her Stepson Kazumi Nakagishi

  • kazumi nakagishi censoredcreampiemature womanSPRDtakara eizokyuta tukumoaleddinSPRD-1350SPRD135018sprd01350
    • 2020-11-29
    96 min

    [VEC-454]My Mom's Best Friend Misa Kuroki

  • misa kuroki censoredcreampiebig titsVECvenusbingo tamatsukamegami venusVEC-454VEC454vec00454
    • 2020-12-13
    120 min

    [GMA-014]Breaking In My Wife With S&M - Married Woman Agrees To Get Tied Up To Model For A Naughty Artist... Momo Hazuki

  • hazuki peach censoredmature womanbdsmGMAglobal media annexGMA-014GMA014gma00014
    • 2020-12-18
    53 min

    444KING-022 Minami-san

  • amateur censoredcreampiemarried womankingking-022king022444king-022
    • 2020-12-23
    48 min

    FC2PPV 1617526 [Personal shooting] 18-year-old neat and clean beautiful girl ④. Creampie in the vagina at the sports festival bloomers ♡ Seeding competition between boyfriend and uncle Enko ♡ “Please make me pregnant with Enko O-nchin … ♡&#

  • amateur uncensoredfc2
    • 2020-12-25
    51 min

    [MASE-009](Online Only) Madam In Her Forties - Wealthy Wife - Horny & Creampie-Crazed

  • censoredcreampiemarried womanMASEcrystal picturemadam maniac plusMASE-009MASE00949mase00009
    • 2020-12-25
    130 min

    [PED-004]Spending 7 Hours Alone With Her As An Experiment... We Ended Up Fucking 10 Times. Miho Tono

  • miho tsuno censoredsingle workPEDdream ticketkurumi ichinosePED-004PED00424ped00004
    • 2020-12-26
    118 min

    [MIDE-864]Class Reunion NTR - My Girlfriend's Horrible Cuckolding - Fumika Nakayama

  • nakayama fumika censoredbig titssingle workMIDEmoodyzdragon nishikawamoodyz divaMIDE-864MIDE864mide00864
    • 2021-01-09
    118 min

    [MEYD-649]If You Can't Make The Rent You're Welcome To Pay It With Your Wife's Body. Kyoko Maki

  • maki kyoko censoredcreampiebig titsMEYDtameike gorohirokoji osakiMEYD-649MEYD649meyd00649
    • 2021-01-15
    122 min

    [ZEX-400]"It Looks Like You've Missed The Last Train Home..." I Have A Girlfriend, But I Went To The Corporate Apartment Of My Devilish Colleague, And She Stood There Before Me, With No Bra Or Panties On, With No Makeup On, And Hit Me Wit

  • abe mikako censoredcreampiebeautiful girlZEXpeters maxZEX-400ZEX400h-720zex00400
    • 2021-01-23
    143 min

    [JUL-441]She Might Be A Cougar, But She's Still Cute - She Might Be Cute, But She's Still Nasty. Natural Succubus, Man-Eating MILF Marika Kobayashi, Age 46, Makes Her Porn Debut!

  • marika kobayashi censoredmature womansingle workJULmadonnamametaro mamezawaJUL-441JUL441jul00441
    • 2021-01-24
    125 min

    [TKSH-019]Double Masochist Volleyball Player Shiori Ebina

  • ebina shiori censoredcreampiebig titsTKSHtoyohikozarakiseiunkaiTKSH-019TKSH019tksh00019
    • 2021-02-01
    176 min

    [YMDD-213]Woofer Bitch: Pick Your Woman, Pick Your Time, Pick Your Place!

  • nene tanaka ayuka kuroda censoredblowjobbeautiful girlYMDDmomotaro eizodukewakamomoYMDD-213YMDD213ymdd00213
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-14
    61 min

    HEYZO 2458 Having Lovely Time With A Big Tits Amature Gril – Mai Maruyama

  • mai maruyama uncensoredcreampieheyzo
    • 2021-02-17
    118 min

    [GVH-193]This Slut Love Exhibitionism, G*******gs, And Bukkake! Amu Hanamiya

  • hanamiya amu censoredslutsingle workGVHglorythin bladeGVH-193GVH19313gvh00193
    • 2021-02-18
    118 min

    [PPPD-907]Bouncing Creampie Sex With A Slut With Colossal Tits - An Aphrodisiac Drives Her Wild For Her Most Earth-Shattering Orgasms Ever! Yukino Nagisa

  • yukino nagi censoredcreampiebig titsPPPDoppaiPPPD-907PPPD907pppd00907
    • 2021-02-18
    149 min

    [PPPD-905]My Girlfriend's Older Sister Tempts Me With Her Big Tits, Telling Me It's OK To Creampie Her - Ranka

  • ranka censoredcreampiebig titsPPPDoppaiPPPD-905PPPD905pppd00905
    • 2021-02-23
    47 min

    H4610 ki210223 Arisa Koike 24years old

  • amateur uncensoredh4610
    • 2021-02-27
    90 min

    FC2PPV 1702653 Celebration! A total of over 20,000 thank-you projects! [Big Cock Big Mara Subordinate x Miraculous Beauty BODY Beauty and 3P] The daughter of the president’s daughter has also grown up w Drinking with 3 people and getting drunk a

  • amateur uncensoredfc2
    • 2021-03-05
    89 min

    [DOKI-019]Gripping A Highly Sensitive Girl/Yume

  • amateur censoredDOKIorustak softDOKI-019DOKI019
    • 2021-03-06
    43 min

    H0930 ki210307 Hirono Suematsu 30years old

  • amateur uncensoredh0930
    • 2021-03-12
    92 min

    380SQB-092 Tsubasa

  • amateur censoredbig titsamateursqbsqb-092sqb092380sqb-092
    • 2021-03-15
    54 min

    FC2PPV 1727715 Gonzo with a 36-year-old married woman! !! Go on a hot spring trip with a very neat wife and go crazy! !! As usual, I’m fluttering and rolling! [High image quality]

  • amateur uncensoredfc2
    • 2021-03-19
    58 min

    SNYZ-023 Rameru-chan

  • amateur censoredamateurcosplaysnyzsnyz-023snyz023snyz-023
    • 2021-03-19
    57 min

    [ETQR-210](Daydream POV Fantasies) Deep And Rich Sex With A Gorgeous Office Lady Yukine

  • censoredcreampieuniformETQRerotic timeETQR-210ETQR210h-1186etqr00210
    • 2021-03-22
    148 min

    [APKH-168]Cute, Tiny Teen With Braided Hair Takes A Load From A Guy Older Than Her Dad! Wild POV Footage Of A Beautiful Y********l In Uniform Miruka Aoyama

  • do you see aoyama censoredcreampieschoolgirlAPKHaurora project annexhaurora project anexAPKH-168APKH168apkh00168
    • 2021-03-28
    62 min

    413INST-108 [Idol back photo session] Hidden big tits F cup 23 years old! Top secret personal photo session that the topical energetic idol exposes his face

  • amateur censoredcreampiebig titsinstinst-108inst108413inst-108
    • 2021-04-03
    240 min

    [MMB-358]Beautiful Wife Trip! ~ This Is Our Chance, Let's Go On A Trip! Hot Sex Vacation With Beautiful Wives From The Countryside!

  • censoredmarried womanamateurMMBmomotaro video publishingdr ishikiri bridgemomotaro bestMMB-358MMB358mmb00358
    • 2021-04-09
    120 min

    [MIDE-911]Barely Legal Runaway Tied Up For Ravishment - Breaking In A Confined Teen From Dawn Till Dusk For Days Sakura Miura

  • minamata sakura censoredbig titssingle workMIDEmoodyzmoodyz divaMIDE-911MIDE911mide00911
    • 2021-04-09
    161 min

    [FFFS-026]Taking MILFs Home To Fuck! Married Sluts Enjoying Strangers' Cocks Caught On Camera! Voyeur Footage 23 - Nympho Wives In Their Forties Crave Cock Milk Edition - Ms Kanako, I-Cup, Age 41, 6' Tall Slut - Ms Sanae, F-Cup, Age 40, Looks

  • censoredmature womanFFFSmature woman private videos emmanuellemanji groupFFFS-026FFFS026fffs00026
    • 2021-04-28
    85 min

    435MFC-101 [Nurse’s egg that gets horny in seconds] Gonzo from daytime with a metamorphosis nursing student who really likes erotic things! A 20-year-old young-faced slender beauty always smiles with a super-dreadnought M temperament no matter w

  • amateur censoredcreampieamateurmfcmfc-101mfc101435mfc-101
    • 2021-04-28
    312 min

    [AOZ-299]Following And Groping Female S*****ts Indecent Fucking Video

  • morinichi hinako narita tsumugi censoredcreampieAOZaozora softAOZ-299AOZ299
    • 2021-06-06
    35 min

    318LADY-376 Ayu

  • amateur censoredbig titsamateurladylady-376lady376318lady-376
    • 2021-06-27
    169 min

    [MDVHJ-034]"Forgive Me For Being Such A Slut" Wives Made To Cum Over And Over By Their Brother-in-Laws' Huge Dicks...

  • ryo fukutomi morita benio censoredbig titsmarried womanMDVHJgraffiti japanmovieMDVHJ-034MDVHJ03448mdvhj00034
    • 2021-06-30
    135 min

    [GVH-257]Anal Ballerina 6 - Erena Takeda

  • elena takeda censoredanalsingle workGVHglory questchintaGVH-257GVH25713gvh00257
    • 2021-07-09
    122 min

    [UMD-785]Weight Loss Aphrodisiac Clinic 4 Girls Start Off Being Wary Of The Suspicious Doctor, But As Soon As They're Loaded Up On Aphrodisiacs All They Care About Is Pleasure!

  • nene tanaka yoshine yuria censoredbig titssquirtingUMDleodragon nishikawaUMD-785UMD785125umd00785
    • 2021-07-09
    150 min

    [IPIT-019]A Healing Beauty Who Is a Top Pick at a Members-Only Lounge Where Ordinary People Are Not Allowed: A Mountaintop Flower Beyond Our Reach. Hitomi Hoshitani's AV Debut

  • hitomi hoshitani censoredblowjobsingle workIPITidea pocketmichiru arashiyamaideapocket talent discovery projectIPIT-019IPIT019ipit00019
    • 2021-07-15
    124 min

    [MKON-057]My Clean Freak Girlfriend Got Soiled And Creampied By A Gross Old Man In His Foul Smelling Dump Of An Apartment - Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiesingle workMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-057MKON057mkon00057
    • 2021-07-20
    60 min

    HEYZO 2572 Toying With Sweaty Hot Chick! Vol.2 – Kurumi Kokoro

  • kurumi kokoro uncensoredcreampiehandjobheyzo
    • 2021-07-30
    153 min

    [SSIS-140][Unusual Climax] Maximum Erotic Awakening! Non-top Fucking With Kozua Fujita Until She Is Satisfied!

  • kozue fujita censoredsquirtingbeautiful girlSSISs1 no 1 styleusapyonSSIS-140SSIS140ssis00140



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download