big tits javcensored housewife censored nampa




FC2SSNISSISHZGDSTARSGMEMMILKROYDAUKGMIAADASDSANKSBJBBANCHRVFSDSSPPPDMARAAVSANACRSQTE

2020-10-17
119 min

[SSNI-903]My Boss Was Away On A Business Trip For Three Days, So I Creampied His Wife Again And Again! With Miu Nakamura

  • miu nakamura censoredcreampiesingle workSSNIs1 no 1 stylezaku araiSSNI-903SSNI903ssni00903
    • 2020-10-17
    477 min

    [OFJE-279]Rara Anzai 1st BEST Collection

  • anzai rara censoredbig titsbeautiful girlOFJEs1 no 1 styleOFJE-279OFJE279ofje00279
    • 2020-10-21
    46 min

    330PER-321 Miyoshi (28)

  • amateur censoredamateurperper-321per321330per-321
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-11-01
    128 min

    [SQTE-338]A Beautiful Blonde Woman Looking Back: I'm Sorry I Am A Monster Of Sexual Desire June Lovejoy

  • june lovejoy censoredbig titssquirtingSQTEs cuteSQTE-338SQTE338sqte00338
    • 2020-11-19
    48 min

    285ENDX-315 Charismatic clerk of famous apparel who never releases Ji Po Squirting erotic female college student 2 consecutive villas Saddle cum shot

  • amateur censoredcreampieamateurendxendx-315endx315285endx-315
    • 2020-11-22
    124 min

    [CAWD-150]She Actually Has A Submissive Streak! Although She Debuted Wanting To Dominate Guys, She Ended Up Loving Being Submissively Fucked In This Complete Record

  • mizuki minami censoredcreampiebeautiful girlCAWDkawaiiCAWD-150CAWD150cawd00150
    • 2020-11-25
    66 min

    [orec-643]まいか先生

  • amateur censoredamateurbeautiful girlorecorec-643orec643orec-643
    • 2020-11-29
    79 min

    [BAB-017]This Lingerie Shop Girl Wanted Some Raw Sex

  • censoredbig titsblowjobBABbabylon daydreamersBAB-017BAB017bab00017
    • 2020-12-10
    127 min

    [BNST-021]Nipple Shot! Devilish Nipple Slut In Uniform Nonstop Teasing Your Nipples - Wan Horikita

  • horikita wa censoreduniformslutBNSTteacher delusion groupthere is alsoBNST-021BNST021bnst00021
    • 2020-12-30
    52 min

    FC2PPV 1625340 Until 1/4 [Uncensored] Tall Galne Cafe Footjob / Continuous Creampie

  • amateur uncensoredfc2
    • 2021-01-01
    96 min

    [VENU-996]I Can't Live Without My Stepson... Sexy Stepmoms Indulge In the Ultimate Erotic Creampie Fucks - 50 Incredible Orgasms Yu Shinoda

  • shinoda yu censoredcreampiebig titsVENUvenuspeterfakecest winntersVENU-996VENU996venu00996
    • 2021-01-07
    131 min

    [AKDL-074](An Amateur Interview) Before She Goes Abroad To Study Ballet, She's Starring In This Adult Video "Limber-Limbed Sex" Before She Goes To The UK, She Wants Some Cock... Swan 20 Years Old Occupation: Ballet Dancer

  • censoredamateurAKDLaquinoriaquinoriaknrAKDL-074AKDL0741akdl00074
    • 2021-01-09
    154 min

    [JUFE-246]Dual Sexy Voices: Sweet Angel & Domme Slut's Ultimate Teasing Akari Niimura

  • akari shinmura censoredbig titsslutJUFEfitchaida yumenoJUFE-246JUFE246jufe00246
    • 2021-01-14
    127 min

    [MEKO-199]New "Rent-A-MILF" Service 05 - We Tried The Most Extreme Requests We Could Think Of From The Housecleaning Service Everybody's Saying Will Go All The Way To A Creampie

  • censoredcreampieamateurMEKOmature woman laboMEKO-199MEKO199h-1160meko00199
    • 2021-01-15
    17 min

    FC2PPV 1646343 [Limited quantity] Shaved girl special [Super rare]

  • amateur uncensoredfc2
    • 2021-01-30
    152 min

    [MIDE-876]Rough G*******g Sex With A Female Teacher - Rough Deep Throat/Group Shaming - Nana Yagi

  • nana yagi censoredblowjobsingle workMIDEmoodyzbungo maedamoodyz divaMIDE-876MIDE876mide00876
    • 2021-02-02
    140 min

    [STARS-325]Slutty Personal Trainer Makes Her Client Give Her A Creampie - His New Bride's Pregnant, So He's Gone Sexless For Months Yuna Ogura

  • yuna ogura censoredcreampieslutSTARSsod createbungo maedasod starSTARS-325STARS3251stars00325
    • 2021-02-22
    133 min

    [OPPW-087]She Tried Meeting Men Online And Went To Meet Them Ready To Fuck, But They All Turned Out To Be Perverts With Abnormal Fetishes, So, Feeling Unsatisfied, She Decided To Make Her Debut As An AV Porn Actress To Get Her Fill Of Sex! Kanade Asa

  • asahina kanade censoredsingle workOPPWopenipeni world mousouzokuumanosukeOPPW-087OPPW087oppw00087
    • 2021-03-07
    181 min

    [YMDD-222]First Time Shots An Amateur Documentary - We're Not Letting This 3-Star Amateur Get Away -

  • censoredcreampieamateurYMDDmomotaro eizoasakusa ga jirowakamomoYMDD-222YMDD222ymdd00222
    • 2021-03-09
    54 min

    FC2PPV 1719080 First shot ❤️ Petite and slender, but being mischievous by a de S twinte girl [Personal shooting]

  • amateur uncensoredfc2
    • 2021-03-24
    104 min

    240TOKYO-423 Yuria

  • amateur censoredanalbig titstokyotokyo-423tokyo423240tokyo-423
    • 2021-03-24
    66 min

    [SDFK-044]"Couples Only" Your Hot Girlfriend Seduced In The One-Way Mirror Cab For Real Creampies! Aiko (24) Hospital Receptionist

  • censoredSDFKsod createyoshiaki nomotomagic mirrorSDFK-044SDFK0441sdfk00044
    • 2021-03-27
    123 min

    [SQTE-365]Sex With A Bombshell Y********l Hinako Mori

  • hinako mori censoredcreampieblowjobSQTEs cuteSQTE-365SQTE365sqte00365
    • 2021-04-02
    201 min

    [HUNTA-979]Plain Jane Girl Transforms Into A Full Grown Sexy Woman Wearing A Knit Dress And Thong! Unable To Resist I Immediately Put My Dick In And Came Inside Of Her Over And Over

  • censoredcreampiesisterHUNTAhuntercognac kaminohhh groupHUNTA-979HUNTA979hunta00979
    • 2021-04-09
    131 min

    [IPX-637]Ravished By The Grossest Boss - Pounded By His Huge Cock Until She Cums - Marked By His Seed Rio Kuriyama

  • rio kuriyama censoredsingle workdramaIPXidea pocketamazing meatdishIPX-637IPX637ipx00637
    • 2021-04-25
    66 min

    413INST-116 [Student Idol] JD Secret Photo Session Creampie Saddle SEX Small Tits / Big Ass Estrus [Amateur / Personal Shooting]

  • amateur censoredcreampieamateurinstinst-116inst116413inst-116
    • 2021-05-14
    119 min

    [PPPD-931]"Uh, My Boyfriend Is The Worst" I Shared A Table With A Girl After Her Shift, And When I Noticed She Was Coming On To Me... I Took Her Back To A Hotel For Friday-To-Monday Fuckathon With Amazing, Sweaty Sex Mikako Horiuchi

  • mikako horiuchi censoredcreampiebig titsPPPDoppaiPPPD-931PPPD931pppd00931
    • 2021-05-14
    118 min

    [BLK-498]I Opened The Door And Suddenly This Gal Was Sucking Me Off!! The Backdoor Cock Eating Service Of An Innocent Bitch!! Wan Horikita

  • horikita wan censoredblowjobslutBLKkira kirakira kira black galBLK-498BLK498blk00498
    • 2021-05-15
    50 min

    Pacopacomama 051521_477 Mature Lady Piledriver Position BJ : Sakura Kazuki

  • amateur uncensoredpacopacomama
    • 2021-06-11
    39 min

    480FRIN-036 Atami Ryokan User Couple Secretly Hidden Camera [Esthetician Wife G Cup 30 Years Old]

  • amateur censoredcreampiebig titsfrinfrin-036frin036480frin-036
    • 2021-06-22
    77 min

    FC2PPV 1881412 * Limited time price [2480PT⇒1980PT] Miss business trip Menes I took a gonzo secretly

  • amateur uncensoredfc2
    • 2021-06-24
    120 min

    [FSDSS-244]The Boundless Perversion Of A Middle-Aged Teacher - His Massage Techniques Make A High S*********l's Sensitive Body Cum - Noa Miura

  • miura noai censoredbig titsuniformFSDSSfalenoflagmanfaleno starFSDSS-244FSDSS2441fsdss00244
    • 2021-06-26
    64 min

    H0930 ki210627 Takai Junko 37years old

  • amateur uncensoredh0930
    • 2021-07-06
    78 min

    345SIMM-651 [NTR] Cuckold A Mysterious Newlywed Wife! A married woman who is excited about the body of a male nude model will forgive even brood parasite seeding … [Memorial nude photo shoot]

  • amateur censoredcreampiebig titssimmsimm-651simm651345simm-651
    • 2021-08-07
    123 min

    [BAHP-085]STRAWBERRY PUSSY ASAHINA KAREN Karen Asahina

  • karen asahina censoredcreampiebeautiful girlBAHPbarutanyoshida daibutsuhoppinBAHP-085BAHP085bahp00085
    • 2021-08-07
    152 min

    [DPMI-061]Raw Sex Queen Yumi Saeki ka

  • yuka saeki censoredcreampiesingle workDPMImirudopamixDPMI-061DPMI061dpmi00061
    • 2021-08-21
    240 min

    [OKAX-764]240 Minutes Of Dripping Sex Battle Royale! Hot Amateur Cougar Wives Being Seduced And Fucked!

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-764OKAX764okax00764
    • 2021-09-04
    157 min

    [MMKZ-101]A Cute Face And A Big Ass!! Rina Takase

  • rina takase censoredbig titssingle workMMKZmarrionmiyamoto kojirouirisMMKZ-101MMKZ101mmkz00101
    • 2021-09-10
    226 min

    [HUNTB-096]"I Don"t Think I"ll Get Another Chance... So I"m Telling You Now: I"m In Love With You." The Story Of How My Coworker Boldly Invited Me Back To Her Place.

  • censoredblowjobbeautiful girlHUNTBhunterspace nyanjirohhh groupHUNTB-096HUNTB096huntb00096
    • 2021-10-02
    64 min

    188HINT-0482 Mizuki

  • amateur censoredbig titsamateurhinthint-0482hint0482188hint-0482
    • 2021-10-08
    119 min

    [IPX-736]Sexy Girl Working Part-time Has To Put On A Revealing Miniskirt For Her Terrible Boss, Leading To Sexual Harassment And Amazing Fucking. (Getting A Jealous Hard-on). Miu Shiromine

  • shiramine miu censoredblowjobsingle workIPXidea pocketzack araitissueIPX-736IPX736ipx00736
    • 2021-11-12
    65 min

    259LUXU-1497 Luxury TV 1482 The Carnal Desire Has Ignited Since The Last Appearance! ？？ The President’s Daughter Who Is Familiar With That Beautiful Big Tits Reappears! "I Want To Be Blamed Forcibly And Be Squid Many Times …" Dresse

  • amateur censoredbig titsamateurluxuluxu-1497luxu1497259luxu-1497
    • 2021-11-12
    120 min

    [KAM-095]I Brought The Married Woman Part-Timer Home From A Work Party, And Took Hidden Camera Voyeur Footage Of Our Fucks, Then Secretly Sold It As Porn 8

  • censoredcreampiebig titsKAMkarumagroupKAM-095KAM095kam00095
    • 2021-11-13
    122 min

    [ZOCM-011]Spend All Night Making Babies With Adulterous Creampie Sex In Love Hotel Shared With Plain S*****t. Beautiful Fair-Skinned Girl Mai-Chan. Mai Kagari

  • flower hunting censoredcreampieuniformZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-011ZOCM011zocm00011
    • 2021-11-16
    121 min

    [KTRA-347]Creampie Into My Daughter-In-Law"s Shaved Pussy Rio Nakamura

  • rio nakamura censoredcreampieschoolgirlKTRAke toraibuk tribeKTRA-347KTRA347h-094ktra00347
    • 2021-11-26
    174 min

    [T28-608]Fakecest Sex Between A Step Brother Who Just Started Living Alone And His Big Breasted Older Step Sister Who Visits Him

  • censoredbig titssisterT28tmaT28-608T2860855t2800608
    • 2022-01-07
    60 min

    [010722-001]Extremely erotic little devil masseur with sheer nipples

  • anri kizuki uncensoredcreampiecaribbeancom



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download