big 068




FC2DTTAPODONEZJULCHRVCJODBLKAMBIMVSDPPPDFSDSSSTARSMILKGVHHNDMEYDABWEBODAUKGROYD

2020-11-19
68 min

299EWDX-330 Wife of F cup of the fourth year of marriage longing for metamorphosis play

  • amateur censoredcreampiebig titsewdxewdx-330ewdx330299ewdx-330
    • 2020-11-21
    93 min

    [yss-079]みづき(22)

  • amateur censoredamateurcosplayyssyss-079yss079yss-079
    • 2020-11-25
    128 min

    [pow-033]こさかな

  • amateur censoredschoolgirlamateurpowpow-033pow033pow-033
    • 2020-11-27
    119 min

    [RDVHJ-125]Amateur!! Mothers And Daughters Picked Up and Creampied Vol 19

  • censoredcreampiebig titsRDVHJgraffiti japanfairestRDVHJ-125RDVHJ12548rdvhj00125
    • 2020-11-28
    244 min

    [DLIX-009]おっぱいが綺麗な素っ裸の美少女に中出し10人

  • airi sato ayuha ami censoredDLIXsharkdelicious timeDLIX-009DLIX009h-687dlix00009
    • 2020-12-10
    166 min

    [DANDY-741]"A Sexually Frustrated Nurse Whispered Dirty Words In My Ears, Got Me Hard And Fucked Me" vol. 2

  • censoredslutnurseDANDYdandykenkyo momoiroDANDY-741DANDY7411dandy00741
    • 2020-12-11
    69 min

    259LUXU-1336 Luxury TV 1338 Adult cute wife applies for Luxury TV without sex! The bright smile shown in the interview changes completely when the production starts! Whole body convulsions with rich deep kiss and electric massage! Exposing the plump

  • amateur censoredbig titsmarried womanluxuluxu-1336luxu1336259luxu-1336
    • 2020-12-15
    56 min

    345SIMM-574 Best vaginal detox by a super slender slut therapist

  • amateur censoredcreampieamateursimmsimm-574simm574345simm-574
    • 2020-12-18
    230 min

    [DOCP-266]While Their Husbands Were Taking A Few Minutes To Enjoy A Smoke, These Creampie Wives Got Over 10 Cum Shots (Enough To Get Pregnant) From Their Fathers-In-Law

  • kiyoshi maihara hanamiya amu censoredcreampiebig titsDOCPprestigedoc premiumDOCP-266DOCP266118docp00266
    • 2020-12-21
    16 min

    10musume 122120_02 Secret Pussy Collection: Hitomi Ikeda

  • amateur uncensored10musume
    • 2020-12-24
    43 min

    [NYH-078]Horny MILF Trains Her Son's Friends' Eager Young Cocks Nozomi Hazuki

  • nozomi hazuki censoredbig titsmilfNYHdirectorsdirectorsnyanjiang houseNYH-078NYH0781nyh00078
    • 2021-01-07
    168 min

    [MADV-502]My Gamer Buddy Was A S********l, So I Invited Her To My Place And Made Her Fuck Me.

  • natsuki kisaragi momoka arisu censoredcreampieuniformMADVcrystal eizoharuo miyafujimaniac crystalMADV-502MADV50249madv00502
    • 2021-01-16
    240 min

    [HUNTA-933]"If I Haven't Had That Much Experience With Sex, Will That Disappoint My Boyfriend...？ Will You Help Me Practice？" A Romantic Consultation NTR With Your C***dhood Friend! In The End, Your C***dhood Friend Can't Take The Plu

  • censoredcreampieHUNTAhunterkawajirihhh groupHUNTA-933HUNTA933hunta00933
    • 2021-01-23
    240 min

    [JKSR-479]@Shinjuku - Rural Wives Only - Picking Up Girls At The Bus Terminal Who've Got Reasons To Cheat 12 Girls, 4 Hours

  • censoredamateurbeautiful girlJKSRbig morkalobockeyprink junkyJKSR-479JKSR47957jksr00479
    • 2021-01-24
    65 min

    FC2PPV 1657650 Actually, this is my first shot! I pioneered the pussy of a college student invited by a cool part-time job with toys and cock ❤️❤️

  • amateur uncensoredfc2
    • 2021-01-31
    46 min

    FC2PPV 1667176 [No] Beauty Pageant tall beauty. Give in to her slender limbs and let her vagina soak in pregnancy juice.

  • amateur uncensoredfc2
    • 2021-02-05
    32 min

    [BTH-116]Because You're Always So Energetic... Even When You Are Crying, I Want You To Laugh - Yui Tomita

  • yu tomita censoredbeautiful girlBTHchobitchchovicBTH-116BTH116h-1435bth00116
    • 2021-02-06
    240 min

    [HUNTA-947]A Forbidden Love Affair With Your Stepmom! "Please! We Don't Need Words, I Just Want You To Fuck Me Furiously! Go Ahead And Keep Fucking Me Until You Get Tired Of Fucking Me!" The Truth Is, I Began Dating My Stepmom...

  • censoredcreampieHUNTAhuntervolvo nakanohhh groupHUNTA-947HUNTA947hunta00947
    • 2021-02-14
    104 min

    390JNT-016 [Cowgirl genius] Picking up a vibe bar clerk who puts an erotic selfie on Lee ● Star! !! The trained and fascinating BODY swells with transcendental rich SEX! Over 1000 people are not Date! !! All the sperm can be brought with a tremendous

  • amateur censoredcreampiesquirtingjntjnt-016jnt016390jnt-016
    • 2021-02-17
    132 min

    496SKIV-004 Mana-chan who loves raw squirrel 2

  • amateur censoredcreampieamateurskivskiv-004skiv004496skiv-004
    • 2021-02-19
    77 min

    [srho-038]なな(20)

  • amateur censoredcreampiebig titssrhosrho-038srho038srho-038
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-03-10
    40 min

    FC2PPV 1719889 No37 A shy girl who is shy. I took a hidden shot of the lewd nature.

  • amateur uncensoredfc2
    • 2021-03-10
    67 min

    FC2PPV 1720568 Shocking [brood parasite] Slender beautiful wife 35 years old SNS ＃ SEX with a raw gonzo shot of a wife who came with sperm donation. Continuous seeding Ahegao without pulling out to the powerful SEX of the unequaled cock younger than

  • amateur uncensoredfc2
    • 2021-03-17
    63 min

    SIRO-4421 [First shot] [Wheat-colored gal] [Piku Piku climax] A 22-year-old manicurist who looks like a half model. Her tan skin was tense and sweaty, and she was also a man’s technique .. Application amateur, first AV shooting 203

  • amateur censoredamateursirosiro-4421siro4421siro-4421
    • 2021-03-19
    128 min

    [BBTU-009]Big Tits And Pussy Juice Squirting! Super Masochistic Married Woman With Big Tits Is Made To Squirt Over And Over Nanao Nakano

  • nanao nakano censoredbig titssquirtingBBTUdogmatenunmy big titsBBTU-009BBTU009bbtu00009
    • 2021-03-20
    60 min

    C0930 ki210321 Mai Katagiri 26years old

  • amateur uncensoredc0930
    • 2021-03-21
    116 min

    [NNPJ-435]We Seduced This Beautiful Half-Japanese Babe Who Lives Overseas On Social Media And Convinced Her To Make Her Adult Video Debut

  • censoredamateurblowjobNNPJnanpa japanNNPJ-435NNPJ435nnpj00435
    • 2021-03-26
    154 min

    [MIFD-152]This Busty F-Cup Lingerie Model Was Way Too Hot For YouTube (Which Got Her Banned) Her Nipples And Pussy Totally Exposed In This Sexy Married Slut's Porn Debut! Sakura Tsuji

  • sakura tsuji censoredbig titssingle workMIFDmoodyzmametaro mamezawamoodyz freshMIFD-152MIFD152mifd00152
    • 2021-03-26
    57 min

    FC2PPV 1737637 [No] The fair-skinned girl’s bar clerk of the E cup is a super nice girl, so I’m going to fuck it and seed it firmly! I want to be her! 【selfie】

  • amateur uncensoredfc2
    • 2021-03-27
    244 min

    [MCSR-432]True Stories: Mature Couple's Swapping Voyeur - 20 Couples, 4 Hours

  • censoredmature womanMCSRbig morkalsaburo kamegashimamascottMCSR-432MCSR43257mcsr00432
    • 2021-03-30
    129 min

    [STARS-358]"Why Don't You Bring Your Work Back To My Place？" My Coworker Was So Bangin' Hot In No Panties, No Bra, And No Makeup That We French Kissed And Fucked Until The First Train. Makoto Toda

  • makoto toda censoredcreampiebeautiful girlSTARSsod createbungo maedasod starSTARS-358STARS3581stars00358
    • 2021-04-09
    274 min

    [MDTM-717]Creampie Raw Footage Of A Loose But Highly Educated College Girl Who Is Hunting For Sugar Daddies To Fulfill Her Lust 3

  • censoredcreampiebig titsMDTMuchu kikakutetMDTM-717MDTM717mdtm00717
    • 2021-04-13
    34 min

    FC2PPV 1736645 Roppongi Lounge Miss Rikako and Icha LOVE Sex ❤️ Hot air overflowing from the bathroom ❤️ Vaginal cum shot in this room with purchase privilege

  • amateur uncensoredfc2
    • 2021-04-17
    151 min

    [DASD-851]A Man's Slutty Daughter - Rui Nanase

  • nanase rui censoredbeautiful girlslutDASDdasnao masakiDASD-851DASD851dasd00851
    • 2021-04-22
    65 min

    FC2PPV 1781358 [First shot appearance, demon Iki] G cup beauty big breasts Lori. Show off to passers-by and roll up with a large amount of squirting and adult gachinko sex! Remove the rubber from yourself and finish during life

  • amateur uncensoredfc2
    • 2021-04-22
    124 min

    [FSDSS-207]Getting Up Close And Personal With Views Of A Huge Ass! Minori Kawana

  • real village henan censoredbeautiful girlsingle workFSDSSfalenotake dfaleno starFSDSS-207FSDSS2071fsdss00207
    • 2021-04-27
    179 min

    [MDVHJ-031]I Can't Tell Anyone... Who Could Have Imagined That I Was Being Fucked By My Daughter's Husband... 4

  • censoredbig titsmature womanMDVHJgraffiti japanmovieMDVHJ-031MDVHJ03148mdvhj00031
    • 2021-04-28
    201 min

    [HHH-231]A Thirty-Something Wife And Her First Experiences Before She Turns 30 She's D***king Down Her First Shots Of Cum She's Getting Her First Taste Of A Big Dick, Bigger Than Her Husband's, For Her Creampie Sex Debut

  • censoredamateurHHHviptriple hHHH-231HHH23178hhh00231
    • 2021-06-04
    90 min

    [SS-024]Shining Beauty Himari Kinoshita

  • censoredcreampieamateurSSfine picturesshooting star fine picturesSS-024SS024h-113ss00024
    • 2021-06-04
    44 min

    FC2PPV 1850801 <Personal shooting> Bento shop PART3 <Married woman / Mature woman Gonzo>

  • amateur uncensoredfc2
    • 2021-06-17
    486 min

    [KTSG-013]Clothed Sex Daydream THE Kahanshin Tigers BEST Collection 8 Hours, Part 3

  • even aihara yamamoto miwako censoredbukkakeKTSGlower body tigers delusion grouplower body tigersKTSG-013KTSG013ktsg00013
    • 2021-06-17
    14 min

    FC2PPV 1873287 For a limited time [Individual shooting] Prefectural General Course ③ A girl who is sexually perverted by inserting raw into a burning body after a massage at a cheer club / hot spring hotel.

  • amateur uncensoredfc2
    • 2021-06-19
    240 min

    [REXD-370]Peeping Priest - Voyeur Priest Catches A Widow Masturbating - Well, If She Wants It That Much...

  • censoredcreampieREXDredmanji groupREXD-370REXD370rexd00370
    • 2021-07-02
    53 min

    FC2PPV 1882727 [Personal shooting] Chitose 26 years old Massive launch to delicate and petite newlywed Lori erotic man wife

  • amateur uncensoredfc2
    • 2021-07-08
    72 min

    10musume 070821_01 The Structure Of Woman : Examing a Cutie’s Gorgeous Body Hazuki Doumoto

  • amateur uncensored10musume
    • 2021-07-15
    168 min

    [MMYM-046]Big Tittied Slut Miu Arioka Talks Dirty While Giving Off Pungent Pussy Odor

  • arioka miu censoredbig titsslutMMYMmarrionaida yumenoyumenoMMYM-046MMYM046mmym00046
    • 2021-07-17
    77 min

    355OPCYN-169 Riina Asuka Riina

  • amateur censoredcreampiebig titsopcynopcyn-169opcyn169355opcyn-169



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download