big 062




FC2BLKAPODCAWDCHRVAUKGRBDLULUGMEMSSNIHDKAVEMAPREDPPPDDTTMEYDABWAUKGNGODMVSDBBAN

2021-01-12
482 min

[KTRA-270]10 Baby-faced Beautiful Girls With Small Breasts - 10 Hours, 2-disc Set

  • yukari miyazawa chiaki chiga censoredcreampieschoolgirlKTRAk tribeKTRA-270KTRA270h-094ktra00270
    • 2021-01-28
    97 min

    [HIMA-091]My Lovely Mother Gets Remarried - Yuri Tadokoro

  • yuri tadokoro censoredcreampiemarried womanHIMAcenter villageshibuyahanazono center villageHIMA-091HIMA091h-086hima00091
    • 2021-01-31
    135 min

    [NKD-269]Koichi Takahashi's Adulterous Secret Meeting With A Married Woman 3

  • censoredamateurmature womanNKDnakajima kogyokoichi takahashiNKD-269NKD269nkd00269
    • 2021-02-05
    122 min

    [ONEZ-273]I'm A 40-Year-Old Loser Suffering From Erectile Dysfunction And Now, This Sch**lgirl Who's A Generation Younger Than Me Has Suddenly Fallen In Love With Me And Confessed Her Love For Me, So I Was Able To Fuck Her. Hikaru Minazuki

  • hikaru minazuki censoredcreampieuniformONEZprestigetodoonezONEZ-273ONEZ273118onez00273
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-03-12
    57 min

    [orec-722]ゆきの

  • amateur censoredcreampiebig titsorecorec-722orec722orec-722
    • 2021-03-13
    151 min

    [MIDE-898]Tricked Into Servicing Her Awful Boss On A Weekend Hot Spring Trip, Cumming So Hard She Could Die... Sakura Miura

  • minamata sakura censoredbig titssingle workMIDEmoodyzbacon tanakamoodyz divaMIDE-898MIDE898mide00898
    • 2021-03-21
    65 min

    476MLA-029 [I cup huge breasts] Ginza hostess is a tide splash! !! A devilish woman who contributes 800,000 brand bags to a large customer is incontinent ⇒ Pride collapses! Demon Pis climax where the Sui Cup rotates at high speed like an amusement pa

  • amateur censoredsquirtingamateurmlamla-029mla029476mla-029
    • 2021-03-25
    184 min

    [SVDVD-847]Ravished! The Chains Of Betrayal! Private Girls' School S*****t! If You Don't Want My Creampie, Call Your Friends! She Calls Her Own Mother, Who In Turn Calls A Friend To Take Her Place! Made To Cum With Endless Pounding And Creamp

  • natsu tojo otohana eve censoredcreampiesquirtingSVDVDsadistic villagenew kage kazamabanging girlsSVDVD-847SVDVD8471svdvd00847
    • 2021-04-02
    121 min

    [NDRA-086]The Wife Who Became The Neighbor's Lover 33 Mio Kimijima

  • kimishima mio censoredbig titsmature womanNDRAjet eizomanji groupNDRA-086NDRA086ndra00086
    • 2021-04-08
    52 min

    230OREC-733 Chihaya

  • amateur censoredcreampiebig titsorecorec-733orec733230orec-733
    • 2021-04-15
    242 min

    [PYM-371]Love Juices Dripping Earnestly From Panties - Orgasm Barrage Masturbation!

  • censoredPYMprimoPYM-371PYM371h-283pym00371
    • 2021-04-24
    263 min

    [SIGL-002]Amateur Girls Vol. 2 - 3 Horny Amateur Hotties, Everyone Takes A Creampie

  • censoredcreampieamateurSIGLshirotogaru mousouzokushiroto guardsSIGL-002SIGL002sigl00002
    • 2021-04-24
    78 min

    355OPCYN-165 Hinami

  • amateur censoredbig titsmarried womanopcynopcyn-165opcyn165355opcyn-165
    • 2021-05-01
    83 min

    [MBRAP-023]佐野みな実 優等生はJカップ

  • himesaki hana censoredsoloworkMBRAPspice visualMBRAP-023MBRAP023
    • 2021-05-08
    151 min

    [APKH-173]When I Messaged The Secret Account Of A Beautiful Rich Married Woman (27 Years Old) She Immediately Agreed To Fuck Me! Filming Hot And Steamy Sex With A Slutty Adulterous Wife Wearing A Thong Mia Hanesaki

  • mia hasaki censoredcreampieblowjobAPKHaurora project annexhaurora project anexAPKH-173APKH173apkh00173
    • 2021-05-14
    130 min

    [SSIS-070]Being Fucked By The Teacher After Getting Destroyed By A Male S*****t... Shameful Repeat Climax With Rough Sex - Sayaka Otoshiro

  • otoshiro sayaka censoreduniformbeautiful girlSSISs1 no 1 stylerokusaburo mishimaSSIS-070SSIS070ssis00070
    • 2021-05-21
    55 min

    230OREC-775 Hana

  • amateur censoredcreampiebig titsorecorec-775orec775230orec-775
    • 2021-05-27
    159 min

    [SPRD-1414]My Ex Fuck Buddy...Is My Friend's Mom Sakura Tsukishima

  • tsukishima sakura censoredmature womansingle workSPRDtakara eizokon oriharualeddinSPRD-1414SPRD141418sprd01414
    • 2021-06-11
    120 min

    [MEYD-681]If You Cannot Pay Your Rent, Should We Ask Your Wife To Pay With Her Body Instead？ Haha Kanna Hirai

  • shiori hirai censoredsingle workdramaMEYDtameike gororyo inugamiMEYD-681MEYD681meyd00681
    • 2021-06-12
    146 min

    [EKDV-661]Yuria Yoshine Bounces Her Incredible Big Oily M-Cup Tits On Your Cock Before You Fuck Her Raw!

  • yoshine yuria censoredcreampiebig titsEKDVcrystal eizoe kissEKDV-661EKDV661ekdv00661
    • 2021-06-25
    47 min

    FC2PPV 1886293 [No] [Complete appearance] 22-year-old Faculty of Law Ai-chan Appearance that violates the law for money Conceived by a beautiful law student and vaginal cum shot [* Blow (mouth ejaculation) & undressing / shower hidden shooting ben

  • amateur uncensoredfc2
    • 2021-06-25
    130 min

    [DKD-005]Let's Take A Bath Together At Your House - Amu Hanamiya

  • hanamiya amu censoredbig titshandjobDKDdream ticketham the mcDKD-005DKD00524dkd00005
    • 2021-07-09
    120 min

    [IPX-694]Cum 141 Times! 134 Big Orgasms! 6100cc Squirting! EROS Extreme Trance Climax FUCK. Nanami Misaki.

  • nanami misaki censoredsquirtingsingle workIPXidea pockethasami kukatissueIPX-694IPX694ipx00694
    • 2021-07-22
    237 min

    [SVDVD-868]Shame The New Female Teacher Was Turned Into A Sexual Teaching Tool At An All Boys School She Was Exposed In Front Of Her S*****ts And F***ed To Endure Their Insolent Fingers, Probing And Ravaging Her Pussy! Her Pride Was Destroyed, But No

  • satoshi kuruki yuki s censoredcreampiesquirtingSVDVDsadistic villageista girl and her shameSVDVD-868SVDVD8681svdvd00868
    • 2021-08-12
    240 min

    [DOCP-311]噂の美人看板娘にアタックナンパ！接客も外見も最高な看板娘はセックスも最高にエロい！

  • amateur censoredbig titsamateurdocpdocp-311docp311docp-311
    • 2021-08-24
    50 min

    H4610 ki210824 Maho Katsuragi 25years old

  • amateur uncensoredh4610
    • 2021-08-28
    56 min

    H4610 ki210828 Mika Ariura 23years old

  • amateur uncensoredh4610
    • 2021-09-14
    66 min

    1Pondo 091421_111 Hospitality: Ladies Who Know How To Make Men Cum Sakura Kazuki Nana Kamiyama Rena Yui Kisaragi

  • amateur uncensored1pondo
    • 2021-09-15
    62 min

    444KING-048 Lala

  • amateur censoredcreampiesquirtingkingking-048king048444king-048
    • 2021-09-25
    239 min

    [NASH-578]The Enthusiastic Sucking Of Fully Mature Older Women: 4 Hours, 40 People

  • censoredbig titsblowjobNASHnadeshikoNASH-578NASH578nash00578
    • 2021-10-01
    124 min

    [ADN-347]I Indulged In Passionate Adultery And Sex With My Secretary, A Married Woman, At A Hotel During A Business Trip. Tsumugi Akari

  • akari tsumugi censoredsingle workADNattackersdoragon nishikawaotona no dramaADN-347ADN347adn00347
    • 2021-10-16
    241 min

    [KSBJ-163]Plump Legend Mature Woman BEST 12 People

  • shota chisato natsuko kayama censoredbig titsmature womanKSBJksb planning emanuelKSBJ-163KSBJ163ksbj00163
    • 2021-10-24
    46 min

    404DHT-0326 Nori Good Slender Widow And Anal! Rika 48 Years Old

  • amateur censoredmarried womanamateurdhtdht-0326dht0326404dht-0326
    • 2021-10-28
    56 min

    10musume 102821_01 I Was Tired From Lack Of Sleep, So I Got Tired Many Times Hitom Mukai

  • amateur uncensored10musume
    • 2021-10-29
    65 min

    FC2PPV 2385426 * Limited Time Price & Bonus * [Celebration !! First Lesbian & First Orgy] Beautiful Sister-In-Law Wife Husband Exchange Swapping Plump Busty Sister And Slender Body Sister Are Inserted W Cock While Lesbian Kissing Sensitivity Ma

  • amateur uncensoredfc2
    • 2021-10-30
    52 min

    FC2PPV 2389900 [Reading Notice] Teenage Active Students. The Moment Of Loss Of Virginity. "I Can’t Do It .. I’m Going Home Because I Don’t Need Money …" Her Life Ended With A Big Cry And A Large Amount Of Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-11-06
    114 min

    [ARAN-033]Orgasmic Aphrodisiac A Woman Trembling In The Hellish Upper Limit Of Sensuality Part 1: A Single Mother Experiences A Furious Pussy Pounding

  • censoredARANbaby entertainmentshirouto musume kyousou kyokuARAN-033ARAN033aran00033
    • 2021-11-11
    116 min

    [AARM-035]Straddles Your Face With Panties That Are See-Through From Below Provoking You to Jerk Off.

  • blue hamazaki mao censoredsquirtingAARMaroma kikakukasai kijinaromaAARM-035AARM035aarm00035
    • 2021-11-12
    146 min

    [EBOD-867]139 Climaxes! 120 Convulsions! Squirting 3700ml! Bright-Natured G-Cup Beauty From Hakata. First Creampie And Bareback Climax Documentary. Noa Amaharu

  • ai tenharu censoredcreampiebig titsEBODe bodyu kichiEBOD-867EBOD867ebod00867
    • 2021-11-26
    130 min

    [PED-015]I Left Them Alone Together For Only Seven Hours... And As A Result, They Had Sex 11 Times. Mao Hamasaki

  • hamazaki mao censoredbig titssingle workPEDdream ticketkurumi ichinosePED-015PED01524ped00015
    • 2021-12-03
    120 min

    [ATID-489]I Will Soil Your Beautiful Face With My Semen And Slobber. Tsumugi Akari

  • akari tsumugi censoredbeautiful girlsingle workATIDattackershasami kukain madATID-489ATID489atid00489
    • 2021-12-18
    66 min

    10musume 121821_01 F Cup Boobs Santa Will Serve Your Dick Aki Kawada

  • amateur uncensored10musume
    • 2022-01-05
    124 min

    [NACR-491]The Colossal Tits Wife From Next Door Was Partying Too Hard One Night And Accidentally Came To My Room And Said, "Honey, I"m Home!" Hana Haruna

  • haruna hana censoredcreampiebig titsNACRplanet plusdirector oshichi ku ryuuNACR-491NACR491h-237nacr00491
    • 2022-01-14
    117 min

    [PRED-371]"I Had No Idea That Was An Aphrodisiac ..." My Father-In-Law Were Now Boosted To 100x Sensuality Levels. While My Husband Was Away, We Engaged In Hungry, Ravenous, Deep And Rich Creampie Sex, Over And Over Again ... JULIA

  • julia censoredcreampiebig titsPREDpremiumtrendy yamaguchielegancePRED-371PRED371pred00371
    • 2022-01-14
    119 min

    [MUDR-175]It"s Been Going On Since That Day... A Beautiful Y********l in Uniform Gets S&M Treatment, Some Breaking In, And A Creampie. Kotone Toua

  • toua kotone censoredcreampieschoolgirlMUDRmukuMUDR-175MUDR175mudr00175
    • 2022-01-19
    86 min

    476MLA-064 [Big Breasts I Cup] A Pachinko Clerk With The Strongest Boobs In The Area Is Here! !! Knead, Suck, Pinch! !! "Boobs Burun! Burun!" Do Powerful Breast Shaking Sex (Mikuru Arioka)

  • amateur censoredcreampiebig titsmlamla-064mla064476mla-064
    • 2022-01-28
    92 min

    573DHT-0357 [Yariman Smell Plump Girls] Amazing Technique! [Rolling Semen With A Long Tongue] A Magician With A Tongue! [Natural Soft Milk J Cup] Marshmallow Fucking! [Don’t Let Go If You Suck] Suppon Blow! I Really Like It! Zukkin! Zukkin! Real

  • amateur censoredcreampiebig titsdhtdht-0357dht0357573dht-0357



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download