big 043




FC2BBANKSBJMIAAGMEMSHKDPPPDGVHMEYDSSNIVENUADNBLKHODVMIDVMIDESANKBIMILKNNPJSSIS

2020-09-11
240 min

[SOUD-005]Real Amateur S********ls - 20 Girls - Decadent Sex With Barely Legal Pussy's Got Them Moaning With Pleasure Like They've Never Experienced Before! Special

  • censoreduniformamateurSOUDprestigebest fuckingSOUD-005SOUD005118soud00005
    • 2020-09-12
    66 min

    SIRO-4266 [First shot] [Sensitive girls] [Type where sexual desire appears on the face] Sexy legs extending from a slender beauty’s miniskirt. She has the most cute shy expression, but she reacts sensitively to comfortable places .. AV applicati

  • amateur censoredsquirtingamateursirosiro-4266siro4266siro-4266
    • 2020-09-13
    114 min

    [MOPG-063]I Wish She Could Be A Naughty Slut Who Will Suffocate Me While Tweaking My Nipples Ebi Kuruma

  • coming shrimp censoredanalslutMOPGm o paradisemo goldMOPG-063MOPG063mopg00063
    • 2020-09-18
    67 min

    FC2PPV 1506477 * Limited first shot ♥ Two consecutive shots of a naive and naive 18-year-old unscathed body with a mouth shot and a vaginal cum shot without a break! !! !!

  • amateur uncensoredfc2
    • 2020-09-22
    31 min

    FC2PPV 1510528 Saddle shot of a 20-year-old erotic cute beauty who specializes in back dancers

  • amateur uncensoredfc2
    • 2020-09-24
    74 min

    200GANA-2359 Seriously flexible, first shot. 1532 Successful pick-up of a beautiful Kansai woman with a good feeling! If you get tipsy and rub your boobs in a good mood, you will start to feel your body twisting, and you will make your body mellow an

  • amateur censoredamateurganagana-2359gana2359200gana-2359
    • 2020-09-25
    240 min

    [MBM-214]I Won't Do It With A Young Woman! Beautiful Mature Women's Sensuously Perverted Bodies Fuckable SEX Carefully Selected 12 Women 4 Hours 2

  • censoredamateurmature womanMBMprestigegaro sasazukambmMBM-214MBM214118mbm00214
    • 2020-10-12
    38 min

    475SKCK-001 Kyoko 01

  • amateur censoredanalamateurskckskck-001skck001475skck-001
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-11-06
    14 min

    10musume 110620_01 Love Juice Splash! Look at An Amateur’s Dildo Masturbation Kaori Ota

  • amateur uncensored10musume
    • 2020-11-06
    163 min

    [HUNTA-885]"What!？ Are They Kissing!？" "Aren't They Fondling Their Tits？" I Was Watching Two Girls Getting Hot And Horny With Each Other, And Then They Started Cumming For My Cock! "It's Great To Be Alive!" A Miracu

  • censoredcreampieHUNTAhuntercognac kaminohhh groupHUNTA-885HUNTA885hunta00885
    • 2020-11-09
    80 min

    FC2PPV 1564129 [Uniform Clothes Saddle Creampie & Squirting] I have assisted with my Echiechi daughter with a matching app! Even though it’s so cute, jungle pubic hair! The untreated bristle pussy that is left raw is bechobecho with man juic

  • amateur uncensoredfc2
    • 2020-11-13
    119 min

    [MIDE-845]An Erotic Awakening For An Abstinent 18 Year Old - Watch Her Cum, Scream, And Writhe As She's Teased And Brought To Multiple Orgasms Rikka Ono

  • rokka ono censoredsquirtingbeautiful girlMIDEmoodyzmoodyz divaMIDE-845MIDE845mide00845
    • 2020-11-16
    43 min

    FC2PPV 1572526 ☆ First shot ☆ Complete appearance ☆ Plump body E cup soft breasts beauty ♥ P activity & first Gonzo in trouble with debt ♥ [With benefits]

  • amateur uncensoredfc2
    • 2020-12-13
    123 min

    [DVAJ-489]My Girlfriend Was Gone For Three Days On A Family Vacation, So I Spend The Whole Time Fucking Her Best Friend (Pseudonym) Satori Fujinami

  • satori fujinami censoredsingle workDVAJalice japanjo asagiriDVAJ-489DVAJ489dvaj00489
    • 2020-12-18
    59 min

    FC2PPV 1611460 1000pt OFF until December 24th !! [No / Piece] My lover is Santa Claus !？ My beloved Nana turns into Santa, and the hot spring effect causes a big squirt from her pussy !？ This winter’s best vaginal cum shot! ! * There is a face-u

  • amateur uncensoredfc2
    • 2020-12-27
    58 min

    H0930 ki210101 Kazue Aoi 52years old

  • amateur uncensoredh0930
    • 2021-01-08
    122 min

    [GUN-847]This Is Amazing! Full-body Japanese Carving Women - Rin Sakuraya

  • sakura rin censoredamateursingle workGUNradixmg yukkybatsugun paradoxGUN-847GUN847433gun00847
    • 2021-01-08
    130 min

    [HODV-21541]Pleasure Syndrome Case 5 "Abnormal Lust! Breaking In An Absolute Masochist - Smoking Hot Model Babe Wants To Sub." Aya Shiomi

  • aya shiomi censoreddeepthroatsingle workHODVh m pHODV-21541HODV215415642hodv21541
    • 2021-01-16
    146 min

    [JMTY-042]First Time Shots - Mugi-chan

  • censoredJMTYteacher delusion groupJMTY-042JMTY042jmty00042
    • 2021-01-29
    40 min

    [per-363]あいな

  • amateur censoredbig titssquirtingperper-363per363per-363
    • 2021-01-31
    486 min

    [JUJU-265]The Sex She'll Never Tell Her Husband About "We Show You The Moment A Married Woman Decides To Cheat" Highlights Collection, 10 Girls, 8 Hours

  • censoredcreampiemature womanJUJUjukujo japanJUJU-265JUJU265juju00265
    • 2021-02-01
    108 min

    [HIKR-183]Picking Up Girls In L.A. - Plain Girl In Glasses Wants To Support Her Starving Family, So She Nervously Agreed To Star In Porn Izzy (Age 22)

  • censoredcreampieamateurHIKRhikara delusion grouphollywood saburoHIKR-183HIKR183hikr00183
    • 2021-02-12
    99 min

    [ZOZO-042]Miss Hikari Yuino

  • censoredcreampiebig titsZOZOsadie willenauZOZO-042ZOZO0421zozo00042
    • 2021-02-13
    130 min

    [CESD-974]Girls In Glasses Are Sexy! 3 Impactful Fucking Scenes!! Himari Kinoshita

  • himari kinoshita himari hanazawa censoredblowjobmature womanCESDceleb no tomoCESD-974CESD974cesd00974
    • 2021-02-14
    94 min

    345SIMM-606 A small J ○ who is too nasty regardless of the innocent appearance, licks with a long tongue and slurps and serves paradise ♪ ♪ It’s been a long time with an uncle and it’s alive and it’s a tide Creampie! !! !! [A special d

  • amateur censoredcreampieuniformsimmsimm-606simm606345simm-606
    • 2021-02-25
    15 min

    10musume 022521_01 Secret Pussy Collection: Keiko Miyahara

  • amateur uncensored10musume
    • 2021-02-26
    240 min

    [SIM-112]MILF Creampie G*******g - I Nailed One Horny Mama And She Introduced Me To Her Friend Who Wanted A Creampie Too

  • censoredcreampiemarried womanSIMprestigeshirotomanmanSIM-112SIM112118sim00112
    • 2021-03-27
    95 min

    [VEMA-161]My Beautiful Teacher Is The Homeroom Teacher And My Lover ~ Forbidden Passionate Raw Sex All Day With My Older Girlfriend ~ Yukino Nagasawa

  • yukino nagasawa censoredcreampiemarried womanVEMAvenustamatsuka bingogoddess venusVEMA-161VEMA161vema00161
    • 2021-04-12
    65 min

    SIRO-4446 [First shot] [Beautiful apparel clerk] [Careful smile of semen bettori] An apparel clerk with snow-white skin appears. She is an adult-like girl with a calm behavior, but when her sensitive parts are stimulated, she begins to writhe in a cu

  • amateur censoredamateursirosiro-4446siro4446siro-4446
    • 2021-04-15
    136 min

    [MKON-050]The Story Of How The Girl I Was In Love With Forever Was Stolen By Another Man Right After We Started Dating Chiharu Sakurai

  • chiharu sakurai censoredcreampieuniformMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-050MKON050mkon00050
    • 2021-05-08
    157 min

    [MDBK-177]A Complete POV Little Stepsister Style Maid Delivery Health Call Girl Service Cums With A Shaved Pussy Creampie Option 4

  • ichika matsumoto chiharu miyazawa censoredcreampiecosplayMDBKbazookaMDBK-177MDBK177mdbk00177
    • 2021-06-16
    220 min

    [HUNTB-032]"Stop It, Somebody's Going To Hear!" Stifling Your Voices In A Place That Anybody Might Walk By Leads To The Most Satisfying Sexual Thrill! Soon You'll Always Want To Fuck Where You Might Get Caught

  • censoredcreampieblowjobHUNTBhuntermorikihhh groupHUNTB-032HUNTB032huntb00032
    • 2021-06-17
    120 min

    [SYKH-029]Soft, Pillowy, H-Cup - Huge Tits Lolita Wife With A Hairy Pussy Corrupted By Creampie Sex! Yume, Age 24

  • censoredbig titsbukkakeSYKHleisurely missus emmanuelleSYKH-029SYKH029sykh00029
    • 2021-06-20
    96 min

    [VNDS-3368]A Married Woman Who Sells Life Insurance With A Blowjob 3

  • censoredblowjobhandjobVNDSstar paradisenext toilet r eVNDS-3368VNDS3368h-254vnds03368
    • 2021-06-22
    61 min

    HEYZO 2551 Sexual Lesson For A Slutty MILF – Mari Onodera

  • mari onodera uncensoredcreampieheyzo
    • 2021-07-08
    134 min

    [HBAD-589]A Slut Who Pretended To Be Neat And Clean But Secretely Tempted Me With Her Colossal Tits - Tomoko Kamisaka

  • tomoko kamisaka censoredbig titsslutHBADhibinorokutanzono seishibabeHBAD-589HBAD5891hbad00589
    • 2021-07-18
    159 min

    [FLAV-275]S********ls With Hard Nipples And Big Asses Are Our Meat Urinals For Us To Process Our Sexual Needs - Mizuki Yayoi

  • mizuki yayoi censoredschoolgirlslutFLAVdigital arkdigital ark digital arkFLAV-275FLAV275flav00275
    • 2021-08-14
    82 min

    522DHT-0276 [Exactly High Spec! A Talented Celebrity Wife Is Immersed In Pleasure! ] Unprotected, The Hole In The Butt Is Also Chi ● Ko And Oma ● The Joint Part Of Ko Is Also Exposed And Iku Many Times! "I Can’T Show It To My Husband In Such

  • amateur censoredcreampiemarried womandhtdht-0276dht0276522dht-0276
    • 2021-08-27
    59 min

    Caribbeancom 082721-001 Like The Butterflies: Two Wheels Soapland In Pink Street 16 Maya Misaki, Nanako Asahina

  • amateur uncensoredcreampielesbiancaribbeancom
    • 2021-08-28
    42 min

    H4610 ki210829 Risa Yanagihara 21years old

  • amateur uncensoredh4610
    • 2021-09-04
    54 min

    H0930 ori1611 Yui Higa 30years old

  • amateur uncensoredh0930
    • 2021-09-15
    69 min

    FC2PPV 2207180 "By All Means, Only The Face …" The 18-Year-Old Slender Beauty Student Of 155 Cm Hides Her Face And Does Not Hide Her Pussy!

  • amateur uncensoredfc2
    • 2021-10-01
    128 min

    [HODV-21613]Masochist Genius!! An Extremely Masochistic Barely Legal Girl, A Bottomless Lewd Metamorphosis - Erena Takeda, 19 Years Old

  • elena takeda censoredcreampiedeepthroatHODVh m pHODV-21613HODV216135642hodv21613
    • 2021-10-02
    130 min

    [BIJN-208]The Documentary Orgasmic, Basic Instinct-Baring Sex A Lusty Sex Monster Barrels Through All Limits To Achieve The Ultimate Ecstatic Creampie Orgy Ayaka Mochizuki

  • ayaka mochizuki censoredbig titsBIJNbeautiful witch emanuelbeautiful witchBIJN-208BIJN208bijn00208
    • 2021-10-05
    88 min

    261ARA-509 [Cute Girl] [Seriously Beautiful] Mana-Chan Is Here! The University Is In A State Of Withdrawal Online … I Want To Get Rid Of It Since I Wanted To Meet People! !! Transcendental Cutie With Full-Blown Etch Aura ♪ [Transcendent Slender]

  • amateur censoredamateuraraara-509ara509261ara-509
    • 2021-11-11
    124 min

    [FSDSS-327]My Step-brother Was Away For Three Days. This Is A Record Of Her Moaning And Coming To Life With A Meat Stick Other Than Her Step-Brother"s. Kaname Momojiri

  • kaname momojiri censoredbig titsblowjobFSDSSfaleno2 rentai ritsu 25faleno starFSDSS-327FSDSS3271fsdss00327
    • 2021-11-19
    240 min

    [REXD-387]Small Town Workshop Afterparty - Exhausted Female Employees Get Stripped Down To Their Sweaty Skin...

  • censoredcreampieuniformREXDredgroupREXD-387REXD387rexd00387



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download