big 041




FC2AUKGAMBIJUFEBBANLULUJULBLKVEMACAWDHNDDTTSQTEMARASSISAVSANACRNGODPPPDGVHAWD

2020-11-02
105 min

[ARM-918]Enjoy Getting Her Tongue Relentlessly Stroked All Over Your Ear While She Sucks On Your Little Cock Hole In The Ultimate Threesome Teasing Sensual Pleasure

  • tachibana mary sakura miyuki censoredblowjobslutARMaroma planningshigeo kadowakiaromaARM-918ARM918arm00918
    • 2020-11-13
    241 min

    [MGT-125]Amateur Perversion Revolution vol. 03

  • censoredcreampiebig titsMGTprestigemegatraMGT-125MGT125118mgt00125
    • 2020-11-13
    48 min

    FC2PPV 1568051 [No] 2 weeks in a row! Model body beauty Hina-chan festival! If you get caught, you will be forced to leave the store! ？？ Please see what happened to her easy-to-feel manga cafe w [Personal shooting]

  • amateur uncensoredfc2
    • 2020-11-27
    46 min

    [opcyn-122]うらら(24)

  • amateur censoredcreampieamateuropcynopcyn-122opcyn122opcyn-122
    • 2020-11-27
    121 min

    [SGM-047]New And Beautiful Mature Woman High Class Bathhouse, Rich And Soggy Reiko Kobayakawa

  • kobayakawa reiko censoredbig titsmature womanSGMglobal media entertainmentyayoi nakanosuper global mediaSGM-047SGM047143sgm00047
    • 2020-12-04
    84 min

    300NTK-479 Echi Echi 9 head and body model grade Dirty Santa beauty and flirting raw SEX 4 barrage! !! White Christmas has arrived! !! It’s been a while since the tag came off in SEX and no time! !! Guttsuri First Creampie with no condom! !! Whi

  • amateur censoredcreampiesquirtingntkntk-479ntk479300ntk-479
    • 2020-12-05
    34 min

    FC2PPV 1595157 [Complete amateur] Raw etch with a thick vibe inserted in a healthy beautiful girl who has only dated one person until now

  • amateur uncensoredfc2
    • 2020-12-11
    118 min

    [SUPA-554]Older Girl In Sexy Miniskirt Showing Off Her Beautiful Legs In Black Stockings And Giving A Hot And Steamy Blowjob

  • censoredamateurblowjobSUPAskyu shirotoSUPA-554SUPA554h-244supa00554
    • 2020-12-11
    162 min

    [ZMEN-074]The Little Sister Of This Gal Wanted Her Big Sister's Horny Boyfriend To Tell Her How "Good" She Was, No Matter What, So Every Night, She Would Sneak Into His Bed And Secretly Give Him A Blowjob In Order To Practice Her Dick-Suc

  • hasegawa ju teshima walnut censoreduniformschoolgirlZMENz mennaveZMEN-074ZMEN074h-1371zmen00074
    • 2020-12-18
    129 min

    [LZPL-055]Ryo Hitomi Is A Sadistic Bitch, And Shiori Kuraki Is A Maso Sex Monster And They're About To Fuck

  • ryo hitomi kuraki bookmark censoredlesbianmature womanLZPLlesreultimate ryolezure playLZPL-055LZPL055lzpl00055
    • 2020-12-25
    241 min

    [MDBK-149]おっぱいの大海原へ飛び込め！！巨乳女子だらけのハーレムプレイBEST4時間 3

  • aya mitsuki hebei haruna censoredcreampiebig titsMDBKk m producek taroubazookaMDBK-149MDBK149h-1496mdbk00149
    • 2020-12-29
    48 min

    C0930 tk0026 Yuu Imaki 28years old

  • amateur uncensoredc0930
    • 2021-01-07
    127 min

    [JRZE-020]She's Entering The Biz At 50! Kiyo Morino

  • takayo morino censoredcreampiemature womanJRZEcenter villagedaichi minamijurakuJRZE-020JRZE020h-086jrze00020
    • 2021-01-29
    168 min

    [NIKM-053]The Inner Masochist Awakens! Ultimate Big Tits Masochist Woman's Stigmatization, With Yuria Yoshine

  • yoshine yuria censoredbig titssingle workNIKMnikumoripiNIKM-053NIKM053h-1323nikm00053
    • 2021-02-22
    139 min

    [KATU-078]A Horny Snack Bar Mama With Erect Nipples This Horny Slut Was Super Beautiful With Glamorously Colossal Tits And A Huge Ass

  • censoredbig titsslutKATUkatsuo bussan mousouzokumaglowKATU-078KATU078katu00078
    • 2021-03-01
    299 min

    [DKSB-107]I Love You So Much... That I'll Say The Naughtiest Things To You - Nut-Busting Dirty Talk 5-Hour Intense Special

  • asakura kotomi haruka takami censoredblowjobslutDKSBoffice k sk s bestDKSB-107DKSB10736dksb00107
    • 2021-03-12
    124 min

    [GGEN-012]Female Boss And Her Employee Are Shut Up In A Room And Can't Leave Unless They Fuck

  • censoredGGENprestigetanizoko fu tarou3 jigen mimanGGEN-012GGEN012118ggen00012
    • 2021-03-14
    51 min

    492MERC-255 Smaller Than Small Tits 2

  • amateur censoredsquirtinguniformmercmerc-255merc255492merc-255
    • 2021-03-25
    40 min

    H0930 ki210325 Rin Muroi 29years old

  • amateur uncensoredh0930
    • 2021-04-02
    58 min

    FC2PPV 1743341 [Personal shooting] Kanade 32 years old Massive launch to a sweat duck beautiful wife with outstanding style F cup beauty big tits

  • amateur uncensoredfc2
    • 2021-04-09
    141 min

    [IPX-639]20 Days Without Sex X Aphrodisiac That Makes Her Piss - Lust Driven To Its Limits... Pounded Hard, Then Pounded More! Hikari Azusa

  • azusa hikari censoredbig titssquirtingIPXidea pocketdishIPX-639IPX639ipx00639
    • 2021-04-13
    60 min

    299EWDX-356 Fair-skinned plump big breasts wife has a lewd sexual desire to catch other sticks in 3 years of marriage

  • amateur censoredbig titsmarried womanewdxewdx-356ewdx356299ewdx-356
    • 2021-04-19
    20 min

    FC2PPV 1777111 2800pt → 1200pt [Individual shooting, 3P second half] Seriously covered with pregnancy juice without any help to the violently rampaging meat stick! Two strange sticks are inserted many times that the husband has never done, and finall

  • amateur uncensoredfc2
    • 2021-04-24
    240 min

    [KTKL-097]Love Letters From Southeast Asian Angels Footage From Thailand 7 Girls x 4 Hours

  • censoredcreampieamateurKTKLkittyx delusion tribehearthKTKL-097KTKL097ktkl00097
    • 2021-05-05
    59 min

    Caribbeancom 050521-001 Pretty Small Tits: Eri Saeki

  • eri saeki uncensoredcreampiecaribbeancom
    • 2021-05-11
    142 min

    1Pondo 051121_001 Nozomi Nakase : Nozomi Nakase Special Edition

  • amateur uncensored1pondo
    • 2021-05-27
    42 min

    10musume 052721_01 The Structure Of Woman : Measuring Size of My Barely Legal Body Parts Keiko Miyahara

  • amateur uncensored10musume
    • 2021-06-07
    56 min

    FC2PPV 1857725 [3480 → Limited number 2480] 20-year-old concafe beauty with anime voice ❤️ Gestures are very cute ❤️ Girls K students No panties No bra sailor suit forbidden Saddle shooting ❤️ Rich mass cum shot with raw insertion ❤️

  • amateur uncensoredfc2
    • 2021-06-11
    124 min

    [DASD-875]Thanks For The Stepmom/Stepdaughter. I Knocked The Stepmom Up Decades Ago, Now It's The Stepdaughter's Turn. Michiru Kujo Kotone Toa

  • kujo michiru toua kotone censoredmature womanbeautiful girlDASDdaschinpo dazaiDASD-875DASD875dasd00875
    • 2021-06-12
    133 min

    [USBA-028]Aphrodisiac BDSM - Aphrodisiac-Addled Bukkake Sends This Sub To Heaven Chitose Yuki

  • chitose in the evening censoredbig titssingle workUSBAavs collector ssaburo hiumaavscollector sUSBA-028USBA028usba00028
    • 2021-06-16
    166 min

    [PPPD-936]Dream Resort! Men's Massage Parlor Where Big Titties Are Pressed Up Against You While You're Made To Cum Over And Over! Karen Yuzuriha

  • karen kaede censoredcreampiebig titsPPPDoppaiPPPD-936PPPD936pppd00936
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-01
    31 min

    FC2PPV 1898252 [Individual shooting] With permission from her husband. Lending wife’s vagina is too famous and explodes, ejaculation in the vagina without permission [4K video privilege ant]

  • amateur uncensoredfc2
    • 2021-07-02
    240 min

    [HUNTB-041]A World Where Sex Is Forbidden "You Want To Kiss？!" But In This World, Sex Itself Is Outlawed And Even Taking Your Mask Off Is Prosecuted As Indecent Exposure

  • censoredcreampieschoolgirlHUNTBhunterkorosukehhh groupHUNTB-041HUNTB041huntb00041
    • 2021-07-09
    120 min

    [IPX-684]Portable Nurse Call Button Allows Blow Jobs 24 Hours a Day! Nympho Nurses who Love Immediate Fellatio Iyona Fuji

  • iyo fujii censoredblowjobbeautiful girlIPXidea pocketsuisei akaidishIPX-684IPX684ipx00684
    • 2021-07-24
    71 min

    SIRO-4602 [First Shot] [SSS Class Super Sensitive Body] [Endless Squirting] A Talented Material That Combines The Best Sensitivity With The Best Body Has Appeared. While Fascinating A Technique That Does Not Seem To Be 21 Years Old, She Happily Licks

  • amateur censoredsquirtingamateursirosiro-4602siro4602siro-4602
    • 2021-07-29
    92 min

    [FUGA-049]The Wife Who Will Fuck The Criminal To Get Back Her K****pped Husband: Yuka Mizuno

  • yuka mizuno censoredcreampiemarried womanFUGAcenter villagejiro fukagawaparadise center villageFUGA-049FUGA049h-086fuga00049
    • 2021-09-24
    137 min

    [JUL-718]This Married Woman Was Unleashing A Furious Windstorm Of Ass-Shaking Sex, Dripping With Sweat, And I Ended Up Creampie Injecting Her Without Ever Moving A Muscle. Maiko Ayase

  • maiko ayase maria sawaguchi censoredcreampiemature womanJULmadonnakoyama masatsuguJUL-718JUL718jul00718
    • 2021-10-16
    120 min

    [KSBJ-161]This Stepmom Had A Stepson Who Was Held Back A Year, And It Might Be Because She Confused Him With Her G-Cup Titties Yurika Aoi

  • yurika censoredcreampiebig titsKSBJksb kikaku emmanuellesakura ninKSBJ-161KSBJ161ksbj00161
    • 2021-10-18
    32 min

    FC2PPV 2356940 Until Today! Appearance! "# 10" A Friend Of The Same University. Harlem Sex With Two Beautiful Girls. The Greatest Happiness Ever. ♡ Dream World ♡

  • amateur uncensoredfc2
    • 2021-10-21
    186 min

    [NHDTB-593]Bring Me A Woman More Powerful Than You! - A Female Office Worker Gets Called Out, Fucked And Creampied!

  • censoredcreampiebig titsNHDTBnatural highrafutin maeshiroNHDTB-593NHDTB5931nhdtb00593
    • 2021-11-13
    120 min

    [KSBJ-166]A Secret Meeting on An Unsafe Day, My Younger Brother in Law"s Sperm Made me Pregnant...Kaho Imai

  • natsuho imai censoredcreampiebig titsKSBJksb kikaku emmanuellesakura ninKSBJ-166KSBJ166ksbj00166
    • 2021-12-03
    180 min

    [MIDV-013]Quiet, Anti-social Longtime Friend Offers Irresistible Temptation. Full-on Panty Shot Showoff. Catching A Glimpse Gives Me A Huge Bulge From My Big Dick, Making Her Hot And Soaking Wet With Excitement When She Sees It! Hana Kotone

  • ryoko sena miu natsume miu harukawa lisa natsume iori censoredlesbianmature womanMIDVmoodyzgoemonmoodyz divaMIDV-013MIDV01348midv00013
    • 2021-12-17
    118 min

    [PPPD-987]I"m Tempted By My Girlfriend"s Older Sister Who Has Big Tits And Likes Creampies Kisaki Arisu

  • kisaki alice censoredcreampiebig titsPPPDoppaiPPPD-987PPPD987pppd00987
    • 2022-01-08
    116 min

    [NSFS-056]A 2-nights And 3-day Couples Swapping Camp - Iori Nanase

  • iori nanase censoredsingle workdramaNSFSnagae stylejotaro tomiNSFS-056NSFS056nsfs00056
    • 2022-01-13
    108 min

    [XMOM-039]Unfaithful Wife Opens Her Legs Lewdly Iori Nanase

  • iori nanase censoredcreampiemarried womanXMOMcenter villagesky cloudspink breathXMOM-039XMOM039h-086xmom00039
    • 2022-01-14
    88 min

    [VEMA-174]My Beautiful Female Teacher Is Also My Club Advisor, And Also My Girlfriend And Lover - Forbidden, Passionate Creampie Sex, From Morning To Night, With My Older Girlfriend - Misono Mizuhara

  • suwon miso censoredcreampiebig titsVEMAvenuspetermegami venusVEMA-174VEMA174vema00174
    • 2022-01-22
    113 min

    [BLOR-187]Serious Career Woman Gets Fucked! Peeling Off Her Clothes, She Reveals A Curvy Figure And Big Tits. This Sharp, Intellectual Woman Loses Her Fucking Mind Cumming As Diamond-Hard Cock Thrusts Inside Her

  • censoredbig titsBLORbroccoli mousouzokubroccoliBLOR-187BLOR187blor00187



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download