best omnibu beautiful girl javcensored hours more censored




FC2PREDADNHNDCJODNNPJSTARSFSDSSNACRMIDVMILKSQTESANAVSAAPODAUKSPPPDMEYDNATRWANZONEZ

2020-11-13
140 min

[SCOP-692]The Hot Spring Resort Aphrodisiac There's This Secret Hot Spring Resort That's Said To Have Beneficial Properties For Beauty, But It's Also Been Called "The Fountain Of Aphrodisiacs!" When A Woman Enters These Waters, He

  • censoredcreampiebig titsSCOPscoopk taromousouzokuSCOP-692SCOP692h-565scop00692
    • 2020-11-28
    155 min

    [MIFD-138]Go 5 Times A Week For Beautiful Legs! Completed Refined Sweat Sauna College Girl's AV Debut Rina Takase

  • rina takase censoredbig titssingle workMIFDmoodyzmon cmoodyz freshMIFD-138MIFD138mifd00138
    • 2020-12-02
    54 min

    345SIMM-565 Hebereke new graduate OL seduces boss! Drinking at home creates a nice atmosphere → Demonstrate the true character of carnivorous girls!

  • amateur censoredcreampieamateursimmsimm-565simm565345simm-565
    • 2020-12-20
    118 min

    [CAWD-159]She Knows The Key To A Man's Heart Is Through His Stomach - And Balls! This College Girl Works Part Time As A Maid Who Provides Special Services For Her Clients - This Sub Is Ready For Her Porn Debut! Kurumi Yuina

  • nominal walnut censoredcreampiebeautiful girlCAWDkawaiitiger kosakaiCAWD-159CAWD159cawd00159
    • 2020-12-22
    66 min

    SIRO-4369 [First shot] [First year of new graduate] [Eyes to scream] A simple girl in the first year of working life who is a receptionist in the office district. The obedient glossy voice that gradually leaks out .. AV application on the net → AV ex

  • amateur censoredamateursirosiro-4369siro4369siro-4369
    • 2020-12-31
    117 min

    [ADN-287]Hugged So Tight You Can't Breathe - Passionate Adulterous Sex Shihori Kotoi

  • shiori kotoi censoredsingle workdramaADNattackersamazing meatotona no dramaADN-287ADN287adn00287
    • 2021-01-11
    45 min

    362SCOH-023 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [● Red]

  • amateur censoredcreampieamateurscohscoh-023scoh023362scoh-023
    • 2021-01-16
    118 min

    [PPPD-899]My Girlfriend Was Away On A Family Trip For A Week So I Spent The Whole Time Giving Her Busty Best Friend My Creampies. Hana Himesaki

  • himesaki hana censoredcreampiebig titsPPPDoppaiPPPD-899PPPD899pppd00899
    • 2021-01-16
    119 min

    [PPPD-895]Challenge Porn Can You Cum See Me!？ She's A Ginza Club Hostess But She Loves Rude And Crude Hot Plays, And She's Putting Her I-Cup Big Tits On Display During Her Adult Video Debut Mako Aoyama

  • mako aoyama censoredbig titscosplayPPPDoppaiPPPD-895PPPD895pppd00895
    • 2021-01-28
    35 min

    FC2PPV 1662551 [New 1700pt → 1300pt until February 4th] 45 years old, neat and systemic erogenous zone wife and Gonzo! I felt it with S ● X after a long time ♡ [High image quality]

  • amateur uncensoredfc2
    • 2021-01-31
    47 min

    493PKPD-091 [Leaked] Cosplay JD and 3P seeding FU ○ K picked up in Shibuya on Halloween

  • amateur censoredcreampieamateurpkpdpkpd-091pkpd091493pkpd-091
    • 2021-02-06
    188 min

    [URE-063]Original Story: Naruto Chuka Naughty Uncle - Exclusive Mature Beauty's First Film! Chaste Married Woman Corrupted By Pleasure And Trained To Please Him - Faithfully Adapted To The Screen! Ririko Kinoshita

  • kinoshita rinko censoredmature womansingle workUREmadonnakitorune kawaguchiure.comiURE-063URE063ure00063
    • 2021-02-12
    49 min

    FC2PPV 1683388 [Personal shooting] The beauty receptionist of a department store has drastically reduced her work, and she is desperate to earn living expenses! [Creampie]

  • amateur uncensoredfc2
    • 2021-02-15
    480 min

    [NPS-408]Female Director Haruna Amateur Lesbian Seduction: 60 Girls, 8 Hours Best Collection 16

  • abe mikako kato camellia censoredamateurlesbianNPSpetersnampaNPS-408NPS408h-021nps00408
    • 2021-02-16
    64 min

    Pacopacomama 021621_435 This hot wife used to be a model Risa Aikawa

  • amateur uncensoredpacopacomama
    • 2021-02-21
    117 min

    [OAE-208]The Night Of Our Trip, Just The Two Of Us - Anna Kami

  • anna kami censoredsingle workOAEaircontrolOAE-208OAE208oae00208
    • 2021-02-22
    116 min

    [ANZD-066]Her First Sugar Daddy Hunt - A Maso And Secretly Horny Intellectual Babe, Miku-chan (J-Cup Titties) -

  • censoredcreampiebig titsANZDapricotANZD-066ANZD066anzd00066
    • 2021-02-26
    30 min

    359TYVM-133 Tall Plump Body Wife Others Stick Cum Creampie Sex! !!

  • amateur censoredcreampiemarried womantyvmtyvm-133tyvm133359tyvm-133
    • 2021-03-18
    56 min

    [SIROR-054]The Work Of A Mature Woman For Rent - The Secret Side Of A Wife That Her Husband Will Never See - FILE NO.54

  • censoredcreampiebig titsSIRORdispatched.comSIROR-054SIROR054h-1492siror00054
    • 2021-03-20
    120 min

    [NXG-361]Blushing Amateur Wife Can't Believe She's So Wet And Horny After Taking A Shameful High Paying Job...

  • censoredamateurcosplayNXGstar paradisenext groupNXG-361NXG361h-254nxg00361
    • 2021-03-24
    99 min

    240TOKYO-424 Minami

  • amateur censoredamateurcosplaytokyotokyo-424tokyo424240tokyo-424
    • 2021-03-26
    125 min

    374IMGN-007 Ranran-chan

  • amateur censoredamateurbeautiful girlimgnimgn-007imgn007374imgn-007
    • 2021-03-27
    122 min

    [GONE-031]Hot Curvy Tanned Body - Grab Hold Of Yuri Honma 's Glamorous Booty And Pound Her Hard!

  • really censoredbig titssingle workGONEmercuryan erotic tanned elder sisterGONE-031GONE031h-1133gone00031
    • 2021-04-15
    228 min

    [WA-453]Married Women Speak! Stimulating The Clit And Pussy Ultimate Masturbation Soaking Wet With Pussy Juice

  • censoredWAlotusWA-453WA453h-047wa00453
    • 2021-04-20
    88 min

    Caribbeancom 042021-001 Non Stop XXX for 180min : I don’t want to leave again once inserted Vol.2 Riri Shiraki

  • riri shiraki uncensoredcreampiehandjobcaribbeancom
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    240 min

    [PRED-305]PREMIUM V.I.P Beautiful Girls From The 3 Biggest Production Companies Form A Harem 240 Minute Special Aika Yamagishi Nanami Misaki Mizuki Aiga

  • aika yamagishi nanami misaki censoredcreampieblowjobPREDpremiumusapyonelegancePRED-305PRED305pred00305
    • 2021-05-19
    30 min

    396BIG-105 Hina

  • amateur censoredcreampieschoolgirlbigbig-105big105396big-105
    • 2021-06-17
    93 min

    [VEC-481]Wife's Friend Comes Over To Scold Her Playboy Husband After It Was Discovered He Was Having An Affair Misa Amagami

  • misa tenjo censoredcreampiebig titsVECvenuspetermegami venusVEC-481VEC481vec00481
    • 2021-06-20
    119 min

    [OFKU-183]Huge Ass Step-Mom Comes To Tokyo From From Ishikawa Aki Misato Age 50

  • aki misato censoredmature womanmomOFKUstar paradisemom railOFKU-183OFKU183h-254ofku00183
    • 2021-07-14
    122 min

    [FOCS-006]This Is A Truly Convenient, Good Woman My Very Own Big And Beautiful Ass, Free To Fuck As I Like! She's Completely Under My Sexual Control, And I Can Make Her Cum As Much As I Want! "Look, I Know That I'm A Convenient Woman ...

  • miona hori censoredblowjobbeautiful girlFOCSabc mousouzokufocusFOCS-006FOCS006focs00006
    • 2021-07-15
    111 min

    [EVIS-362]Lesbians Sniffing And Licking Steamy And Sweaty Leggings

  • ayaka mochizuki the starry sky censoredlesbianslutEVISebisusan mousouzokucherry tomiyamaEVIS-362EVIS362evis00362
    • 2021-07-16
    38 min

    480FRIN-041 "Personal Shooting" Slender Beautiful Wife’s Stealth Creampie Affair Sex Stealth Hidden Camera

  • amateur censoredcreampiemarried womanfrinfrin-041frin041480frin-041
    • 2021-08-20
    153 min

    [HMN-034]My Girlfriend"s Sister Is So Infatuated With Me We Secretly Started Making Babies, Starring Kasumi Tsukino

  • kasumi tsukino censoredcreampiebig titsHMNhonnakausapyonHMN-034HMN034hmn00034
    • 2021-09-04
    122 min

    [MRSS-119]I Recently Discovered That My Beloved Wife Used To Hunt For Sugar Daddies During Her S*****t Days, And That Her Stepfather Had Been Breaking In Her Pussy, Which Means That She Is A Used Cum Bucket. Hikari Sena

  • hikari sena censoredcreampiebig titsMRSSmisesu no sugao emanuelyumesaki ichiroumisesu no sugaoMRSS-119MRSS119mrss00119
    • 2021-09-11
    129 min

    [REAL-777]女子校生孕ませレ●プ中出し20連発 佐藤ののか

  • is it sato censoredcreampiesquirtingREALk m producegory matsudareal real worksREAL-777REAL777real00777
    • 2021-09-11
    242 min

    [UMSO-413]What Would Happen If You Masturbated In Front Of A Colossal Tits Massage Therapist!？ Highlights 13 Ladies

  • mizuna wakatsuki ama dro censoredbig titsUMSOkm produceumanamiUMSO-413UMSO413umso00413
    • 2021-09-17
    67 min

    230OREC-888 Tsubasa

  • amateur censoredcreampiebig titsorecorec-888orec888230orec-888
    • 2021-09-17
    47 min

    FC2PPV 2214416 [Personal Shooting] Ntr, A Young Wife With Big Breasts Drifting Pheromones Can Not Stand Too Much Sex Appeal And Vaginal Cum Shot! [Amateur Gonzo]

  • amateur uncensoredfc2
    • 2021-09-18
    148 min

    [FLAV-280]Slutty Bunny Girl Is A Carnivorous Masochistic Bitch Alice Otsu

  • otsu alice censoredbig titssquirtingFLAVdigital arkdigital ark dejitarua kuFLAV-280FLAV280flav00280
    • 2021-09-24
    81 min

    259LUXU-1485 Luxury Tv 1461 Relive The Pleasure Of Having A Flexible Hip Joint! That Beautiful Yoga Instructor Is Back On Luxury Tv! Don’t Miss The Acrobatic Play With Bold Legs! (Nana Maeno)

  • amateur censoredamateurluxuluxu-1485luxu1485259luxu-1485
    • 2021-10-13
    91 min

    546EROF-002 [Leaked] K Cup Gravure Private Co-Star And Gonzo Sex (Ena Koume)

  • amateur censoredbig titsamateureroferof-002erof002546erof-002
    • 2021-10-16
    58 min

    519MAZOF-020 [Impact Video] Honor Student, Sex Prepared By An Adult Man Dohamari, Real Masochist Female Cum Shot Sexual Intercourse (Hinako Mori)

  • amateur censoredcreampieuniformmazofmazof-020mazof020519mazof-020
    • 2021-10-23
    244 min

    [SGKX-009]A Gal Chain Reaction Private Video Documentary (Gal-stagram #006) A Special Massive Gathering Of Nookie Gals! A Heaven-Sent Babe Of Spasmic, Orgasmic Erotic Ecstasy! Check Out Her Jiggling And Wiggling G-Cup Colossal Tits! Enjoy Splattering

  • nagi rikax censoredcreampiebig titsSGKXhame chanharii ichigal suta gramSGKX-009SGKX009h-1575sgkx00009
    • 2021-10-24
    42 min

    FC2PPV 2367786 [Limited Price] [Live Mating] Re-Appearance! ︎ A Very Popular Unequaled Model Will Go Out With 2 Consecutive Vaginal Cum Shot With Raw Sex With An Appearance! ︎

  • amateur uncensoredfc2
    • 2021-10-29
    51 min

    [HEYZO-2643]rin POV Fuck With A Pervert Girl Loving To Expose In SNS Vol.01

  • rin uncensoredheyzo
    • 2021-10-30
    58 min

    H4610 ki211031 Eri Sagawa 30years old

  • amateur uncensoredh4610
    • 2021-11-17
    85 min

    420POW-064 Chi ~Yapuche 2 (Minami Iroha)

  • amateur censoredschoolgirlamateurpowpow-064pow064pow-064



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download