beautiful girl def censored uniform jav




FC2WANZHMNVEMAVENUAPODWAAAEBODNATRMILKMVSDHDKAMEYDSANATIDSTARSSQTEMIDVNACRHNDMIDE

2020-11-06
37 min

[ore-717]Yui

  • amateur censoredcreampieuniformoreore-717ore717ore-717
    • 2020-11-13
    147 min

    [MKMP-362]Female Teacher Confinement Creampie G*******g: I Was Gang Fucked By The S*****ts In A School - Iori Nanase

  • iori nanase censoredcreampiebig titsMKMPk m producerakudamillionMKMP-362MKMP36284mkmp00362
    • 2020-11-19
    131 min

    [AKDL-064](An Interview With An Amateur) She Didn't Tell Her School That She Was Performing In An Adult Video This Beautiful And Prim And Proper Girl Looks Just Like Emi Take* But Now She's Transformed Into A Maso Bitch And Pissing Herself To

  • censoredamateurAKDLaquinoriaquinoriaknrAKDL-064AKDL0641akdl00064
    • 2020-11-26
    105 min

    [SPRD-1351]Please Forgive Me... I Want To Have My Son-In-Law's Baby Hitomi Hitachi

  • hitachi hitomi censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1351SPRD135118sprd01351
    • 2020-12-10
    94 min

    FC2PPV 1600511 039 [12 Dopyu Massive Facials] Will JD4, who is about to graduate from college, climb the adult stairs toward working adults？

  • amateur uncensoredfc2
    • 2020-12-13
    180 min

    [AUKS-120]A Crummy, Cramped Apartment - Banned!! Filthy Lesbian Sex Pornography - Toko Namiki Saryu Usui

  • namiki touko sakisui censoredlesbianAUKSu kroshilvia takiguchiAUKS-120AUKS120auks00120
    • 2020-12-20
    118 min

    [CAWD-152]When She's Had Liquor, Look Out! She'll Leap On Any Guy's Dick She Sees And Drain His Balls Dry... This Extreme Slut Won't Take No For An Answer. Mayuki Ito

  • maiyuki ito censoredcreampieslutCAWDkawaiikyoseiCAWD-152CAWD152cawd00152
    • 2020-12-22
    141 min

    [STARS-310]Brilliant, Beautiful Girl Loves To Cum On Huge Cocks! Her Orgasmic Limit - Endless Climaxes From Hard Pounding Nanase Asahina

  • asahina nanase censoredbeautiful girldeepthroatSTARSsod createkaorusod starSTARS-310STARS3101stars00310
    • 2020-12-22
    60 min

    H0930 ki201222 Misa Oohara 45years old

  • amateur uncensoredh0930
    • 2021-01-04
    61 min

    Caribbeancom 010421-001 Luxury Adult Healing Spa: Chisato Takayama

  • amateur uncensoredcreampiecaribbeancom
    • 2021-01-08
    80 min

    483SGK-009 [18-year-old silver-haired gal] [Slender big breasts] [Pitch-pitch] [Undeveloped gal] Gutchuguchu’s pitch-pitch silver-haired black gal’s fantastic raw squirrel 2 shots! 18-year-old skin and sensitive Ma ● Ko is a fire on fire fr

  • amateur censoredcreampiebig titssgksgk-009sgk009483sgk-009
    • 2021-01-09
    32 min

    279UTSU-483 Ayumi

  • amateur censoredcreampiemarried womanutsuutsu-483utsu483279utsu-483
    • 2021-01-16
    242 min

    [MXSPS-660]REQUEST - Beauty With A Beautiful Ass, Rin Asuka

  • asuka ri censoredbig titsmarried womanMXSPSmaxingMXSPS-660MXSPS660h-068mxsps00660
    • 2021-01-20
    120 min

    [VNDS-3358]Naughty Stepson Secretly Strokes His Stepmom's Pussy Underneath The Heater Blanket - They Both Get So Horny Their Sex Fluids Start Gushing

  • masako jouchi tsutsumi maple censoredmature womanmomVNDSstar paradisenext toilet r eVNDS-3358VNDS3358h-254vnds03358
    • 2021-01-25
    52 min

    FC2PPV 1659353 [First cock 2 simultaneous blowjob ❤ complete appearance] Fcup big breasts girl reappears ☆ Masturbation while blowjob handjob w Oil slimy massage & shrimp shaving with finger man torture Dirty beauty big tits Tayun Tayun! With Ful

  • amateur uncensoredfc2
    • 2021-01-29
    61 min

    FC2PPV 1662148 Only now 980pt [First shot first cum shot] Gravure Shinozaki ● Love super similar !! 20 years old Geki Kawa baby face busty female college student and raw squirrel cum shot SEX, further reinsert and scrape sperm

  • amateur uncensoredfc2
    • 2021-02-12
    43 min

    [DHT-233]A Mature Woman And Wife In The Reiwa Era With Plenty Of Issues Is Going On A One-Day Adultery Sex Journey Asami 43 Years Old

  • censoredbig titsmarried womanDHThot entertainmententhusiastDHT-233DHT23359dht00233
    • 2021-02-19
    89 min

    [sqb-089]なぎ

  • amateur censoredbig titsamateursqbsqb-089sqb089sqb-089
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-22
    37 min

    FC2PPV 1697025 [No] [Limited to 100 pieces 2980 → 1480pt OFF!] Masturbation 3 times daily! ♥ ️ Raw Gonzo for girls with strong libido ♥ ️ Massive vaginal cum shot! !! ♥ ️ Body Bikun Bikun ♥ * Review benefits / Sexy underwear blowjob

  • amateur uncensoredfc2
    • 2021-02-28
    140 min

    [KTKL-096]Incredibly Beautiful Y********l Who Auditioned For That Super Popular Idol Group And Almost Made It In Makes Her Dengeki AV Debut - Kurumi Himejima

  • himejima walnut censoredbeautiful girlsingle workKTKLkittyxhearthKTKL-096KTKL096ktkl00096
    • 2021-03-26
    39 min

    480FRIN-025 《Personal shooting》 Entertainment talent Idol 1 ● years old Entertainment class Pillow SEX outflow with serial drama producer

  • amateur censoredcreampieamateurfrinfrin-025frin025480frin-025
    • 2021-03-27
    59 min

    292MY-415 Akina Inamura

  • amateur censoredmarried womanamateurmymy-415my415292my-415
    • 2021-04-02
    186 min

    [HUNTA-977]Monthly All You Can Fuck Program! As Long As You Pay A Monthly Fee You Can Fuck Any Of The Female Employees And Receptionists! 2

  • censoreduniformHUNTAhunterkorosukehhh groupHUNTA-977HUNTA977hunta00977
    • 2021-04-02
    199 min

    [SSIS-031]*No Script! POV! No Makeup! Anything Goes! Rena Kodama's Real Carnal Instincts Unleashed! Rare, Real Fucks On A Couple's Hot Spring Trip - 200 Erotic

  • kodama rena censoredbeautiful girlsingle workSSISs1 no 1 styleSSIS-031SSIS031ssis00031
    • 2021-04-08
    93 min

    [OKK-025]Gorgeous, Glistening Wet Bodies - Goddess In A Competitive Swimsuit - Aoi Kururugi - Enjoy Every Part Of A Petite Hottie Who Looks Barely Legal In A Nut-Busting Competitive Swimsuit! Hidden Camera Voyeur Footage From The Change Room: Close-U

  • aoi kururugi censoredbeautiful girlbukkakeOKKpersonal photography of fatherdivine swimmingOKK-025OKK0251okk00025
    • 2021-04-09
    75 min

    259LUXU-1405 Luxury TV 1389 Fashionable and cool appearance, but in fact it is a wonderful gap called de M! The beauty style that everyone envy, with beautiful legs, nice ass, and beautiful breasts, and the sweet reaction that tickles the man’s

  • amateur censoredbig titsamateurluxuluxu-1405luxu1405259luxu-1405
    • 2021-04-09
    120 min

    [MIAA-419]Cute Seductive S*********ls In Uniform Tempt You With A Smile... Slut Siren tly Ravishes You Asuka Momose

  • momose asuka censoredcreampieschoolgirlMIAAmoodyzwild seveneveryone s porn starMIAA-419MIAA419miaa00419
    • 2021-05-01
    120 min

    [PRED-308]Airi (My C***dhood Friend) Made A Serious Confession To Me That She Wanted To Suck My Dick, So She Spent The Entire Day Giving Me Oral Ejaculatory Pleasure, And I Became Hooked On Her Blowjob Technique ... Airi Kijima

  • airi kijima censoredcreampieuniformPREDpremiumsuisei akaielegancePRED-308PRED308pred00308
    • 2021-05-07
    120 min

    [MEYD-673]Cougar Shows Off Her All-Encompassing Sexual Technique! Married G-Cup Escort Who Looks Amazing For A Woman With C***dren Makes Her Porn Debut

  • censoredbig titsMEYDtameike goromametaro mamezawaMEYD-673MEYD673meyd00673
    • 2021-05-07
    51 min

    230OREC-761 Kotoriasobu

  • amateur censoredcreampiebig titsorecorec-761orec761230orec-761
    • 2021-05-26
    56 min

    SIRO-4485 [First shot] [Pure white beauty body] [Burning soft skin] 19 years old who is good at begging for sweetness. Around the age when a boxed girl who goes to a female college is also interested in sex .. Application amateur, first AV shooting 2

  • amateur censoredamateursirosiro-4485siro4485siro-4485
    • 2021-05-29
    61 min

    C0930 ki210530 Natsuki Mishima 29years old

  • amateur uncensoredc0930
    • 2021-06-04
    69 min

    230OREC-779 Natsuko-san

  • amateur censoredbig titsmarried womanorecorec-779orec779230orec-779
    • 2021-06-09
    72 min

    522DHT-258 [What a Celebrity Wife’s Vulgar Abomination! ] Naked and crawl on all fours and chew other people’s cheeks to the back of your throat! Serve by hanging down! "I want Ochin * n. Please insert it. Insert it quickly!" A lot

  • amateur censoredcreampiemarried womandhtdht-258dht258522dht-258
    • 2021-06-11
    159 min

    [DASD-869]She Can't Stand Her Stepdad... But When He Goes Down On Her This Stepdaughter Has Orgasms Like Never Before - Fakecest Cunnilingus Mei Satsuki

  • satsuki mei censoredcreampiebig titsDASDdasgoemonDASD-869DASD869dasd00869
    • 2021-06-12
    241 min

    [NASH-522]A Married Woman Who Turns Her Husband Into A Cuckold While He Doesn't Notice

  • ayako inoue kumi kanzaki censoredmature womandramaNASHnadeshikoNASH-522NASH522nash00522
    • 2021-06-16
    120 min

    [FOCS-002]Footage Of Big Tits Bouncing - If You Love Massive Knockers, You Won't Want To Miss These Colossal Tits - Picking Up Girls At A Bar Where The Tinder Sluts Are Known For One-Night Stands - Busty But Slim

  • censoredbig titsbeautiful girlFOCSabc mousouzokufocusFOCS-002FOCS002focs00002
    • 2021-06-29
    140 min

    [SDAB-185]It's 7 Hours Remaining Until Curfew Time, And This Beautiful Girl With An Exquisite Body Is Surrounded By 9 Creepy Crawly Dirty Old Man Cocks, Relentlessly Creeping On Her In A Long Day Of G*******g Sex Saya Kuriyama

  • saya kuriyama censoredbeautiful girlsingle workSDABsod createharii ichiseishun jidaiSDAB-185SDAB1851sdab00185
    • 2021-07-01
    103 min

    [IQQQ-025]A Married Female Teacher Who Gets 10 Times Wetter In A Climax Class Where You Can't Make A Noise - Chitose Yuki

  • chitose in the evening censoredcreampiemarried womanIQQQcenter villagesouthern earthzora center villageIQQQ-025IQQQ025h-086iqqq00025
    • 2021-07-16
    39 min

    230OREC-826 Mako

  • amateur censoredcreampiemarried womanorecorec-826orec826230orec-826
    • 2021-07-16
    86 min

    [FTHT-018](Rough Sex! Strung Up Upside-Down For A Blowjob! Pussy-Licking! A Sixty-Nine!) Get Ready To Blow Your Load Over This Totally Outrageous Position! Merciless Booty Spanking! Ass Cheeks Flushed Bright Red! Moaning In Delight! "You Can'

  • censoredcreampiemarried womanFTHTfalenodavielfalenotubeFTHT-018FTHT0181ftht00018
    • 2021-07-27
    63 min

    1Pondo 072721_001 Model Collection: Asuka Motomiya

  • amateur uncensored1pondo
    • 2021-07-30
    78 min

    259LUXU-1453 Luxury TV 1437 Often Not Satisfied With Sex … Such A Beautiful Manager Appears In AV In Search Of The Best Sex. I Feel Trembling With A Rich Caress And Accept The Phallus With A Fascinating Face …!

  • amateur censoredbig titsamateurluxuluxu-1453luxu1453259luxu-1453
    • 2021-08-01
    122 min

    [NACR-450]Hold Me... A Single Mother Who Fell In Love With Her Neighbor - Miu Arioka

  • arioka miu censoredcreampiebig titsNACRplanet plusdirector oshichi ku ryuuNACR-450NACR450h-237nacr00450
    • 2021-08-13
    477 min

    [OFJE-327]A Sleazebag Scene Of The Adultery Of An Extraordinarily Beautiful Married Woman: 50 Consecutive Shots And 8 Hours Of Pleasurable And Unfaithful French Kisses And Sex With Other Guys

  • saki okuda nami hoshino censoredbig titsOFJEs1 no 1 styleOFJE-327OFJE327ofje00327
    • 2021-08-22
    40 min

    FC2PPV 2060301 [Amateur ❤ Creampie] It Was Said That It Would Be Best If You Had A Raw Fuck With A Married Woman In A Sauna & Open-Air Bath ❤ 18th Work [Sauna & Open-Air Bath]

  • amateur uncensoredfc2
    • 2021-08-26
    121 min

    [FSDSS-278]An Infinite Amount Of Bodily Fluids: Continuous Climaxes Of Wildly Coming: A SPECIAL Of 4 Performances. Yui Shirasaka

  • yui shirasaka censoredsquirtingbeautiful girlFSDSSfalenoisoi keifaleno starFSDSS-278FSDSS2781fsdss00278



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download