at




FC2SDABHNDKSBJVENUWAAANACRMARAAUKSROYDAVSAAWDADNSANMIDVSQTEVEMAFSDSSJULCJODMEYD

2023-05-19
120 min

REXD-469 Cleaner Satsuki Mei At The Underground Idol Handshake Event Venue

  • satsuki mei censoredcreampiesingle workREXDredgroupREXD-469REXD469rexd00469
    • 2023-05-19
    140 min

    CJOD-379 When I Woke Up, I Was Alone With The Female President At A Love Hotel.I"m A Newlywed Who Can"t Move And I"m Drunk And I"m Being Forced To Have An Adultery Power Harassment With A Berokisu Creampie... JULIA

  • julia censoredcreampieslutCJODslut haventrendy yamaguchiCJOD-379CJOD379cjod00379
    • 2023-05-19
    240 min

    CJOB-130 I"m Surrounded By Sluts And Sandwiched And Ejaculated At The Same Time BEST

  • ichika matsumoto sumire kuramoto censoredcreampieCJOBslut havenslut haven bestCJOB-130CJOB130cjob00130
    • 2023-05-19
    150 min

    ROYD-128 Yariman Bitch Senpai Who Blows Saddle Tide Excitingly At A Part-Time Job Or At Other People"s Houses Alice Oto

  • otsu alice censoredcreampiesingle workROYDroyalmorikihhh groupROYD-128ROYD128royd00128
    • 2023-05-19
    130 min

    HMN-390 Protein (Semen) Desires Unstoppable Deca-Ass Trainer Squeezed Many Shots At Stakeout Woman On Top Posture Chintre Chanyota

  • chanyota censoredcreampieslutHMNbookhimopan of joytoyHMN-390HMN390hmn00390
    • 2023-05-19
    240 min

    HUNTB-559 In The Morning, I Will Leave On A Flight... At Least Until That Time... I Forgot Myself And Loved My Older Childhood Friend And Intense Sex. She Fulfilled Her Dream Of Becoming A CA She Moved Far Away

  • censoredcreampieHUNTBhunterkawajirihhh groupHUNTB-559HUNTB559huntb00559
    • 2023-05-18
    25 min

    fc2-ppv 3341582 Surprise Plan! Nearly Exclusive Fair-skinned Neat And Clean Older Sister In The Car For The First Time 2 Consecutive Blow Jobs + Bewildered By The Appearance Of A Man Who Is Not Good At The Appearance Orthodox Beauty Mika Vol.6 FC2-PP

  • amateur uncensoredcreampieblowjob
    • 2023-05-18
    112 min

    POMD-003 [Amateur POV] While Staring At Each Other For A Long Time, I"m Going To Have A Good Time SEX. Indecent Mistress Who Loves Pacifiers Kokona Asakura

  • asakura here censoredbig titsbeautiful girlPOMDfave modeswasabi kunPOMD-003POMD003h-1718pomd00003
    • 2023-05-18
    60 min

    SIRO-5064 [Surprised By The First Squirting And Squirting Tide] Sex Has Been A Long Time. But At Work, I Only Meet Cats, So I Applied For An AV Cat Cafe Clerk Application Amateur, First AV Shooting 326

  • amateur censoredsquirtingamateursirosiro-5064siro5064siro-5064
    • 2023-05-18
    79 min

    336KNB-257 [Early Afternoon Mother Gets Wet. ] Busty Mom From Tsudanuma Who Gets Wet Just By Kissing, Applies For AV For Child Support! Get Rid Of The Stress Of Housewife Business With Hard Torture Sex! Moms With Lots Of Children Are Still Erotic...!

  • amateur censoredbig titsmarried womanknbknb-257knb257336knb-257
    • 2023-05-18
    43 min

    HEYZO-3062 Debi [Debi] GIRLS & BOUGA Beautiful Shape, Beautiful Legs, Beautiful Breasts Perfect Erotic Potential MAX Entertainer Debi-chan"s 19-Year-Old Grinding Waist Can"t Fit At All!

  • devi uncensored
    • 2023-05-18
    94 min

    420STH-037 MOMO (26) Amateur Hoi Hoi SH/Match App/Bring Home/Never Break/Let"s Fuck At Home/26 Years Old/No Boyfriend/Good Nori/Big Tits/Sexually Open/Personal Photography

  • amateur censoredbig titsamateursthsth-037sth037420sth-037
    • 2023-05-18
    37 min

    fc2-ppv 3340997 First Shooting / Appearance! ! 3 Days Limited 1980pt! ! In The Park With A Beautiful Office Lady Who Works At A Major Travel Agency And Is Full Of Curiosity... She Explodes Her Sexual Desire, Which She Can"t Usually Satisfy, And C

  • amateur uncensoredcreampieamateur
    • 2023-05-17
    108 min

    435MFC-245 Super Physical Beauty! Rui Niitsuma With A Sassy Six-pack "Ex-boyfriend Liberates Lust! 3 Consecutive Ejaculation At The End Of Unfaithful Acts》I Was Supposed To Just Go To Rice, But I Was Deceived, And I Was Cheated, And I Was Cheated

  • amateur censoredmarried womanamateurmfcmfc-245mfc245435mfc-245
    • 2023-05-17
    63 min

    200GANA-2849 Seriously Flirty, First Shot. 1914 Picking Up A Gentle Camera Girl In Takadanobaba! The Minimum Girl (height 148 Cm) Who Talks And Warms Up Is Actually Frustrated... When I Took It Off, I Was Surprised At The Smooth And Sticky Skin! Grab

  • amateur censoredamateurganagana-2849gana2849200gana-2849
    • 2023-05-17
    33 min

    fc2-ppv 3335723 A Rookie Receptionist With A Charming Smooth Face A Woman Who Can Make 6 Bossy Cocks Of A Business Partner Feel Good At The Same Time 4 Bonus Semen Cum Swallowing 2 Shots And 4 Shots Of Pleasure As A Reward * Review Privilege Is 4K Hi

  • amateur uncensoredcreampieblowjob
    • 2023-05-17
    40 min

    fc2-ppv 3316610 Pregnant Woman 3P! I Rape My Wife (pregnant Woman) With My Husband At The House Of A Russian Couple! Sales Will End Soon. . FC2-PPV-3316610

  • amateur uncensoredcreampie
    • 2023-05-16
    121 min

    STARS-845 I Quarreled With My Boyfriend"s Cheating... A Blonde Gal Was Approached By An Old Man In A Local Parking Lot, And Out Of Revenge, She Had Sex At The Hotel. Kudo Yura

  • kudo yura censoredbeautiful girlslutSTARSsod createtiger gavelsod starSTARS-845STARS8451stars00845
    • 2023-05-16
    201 min

    SDJS-196 SOD Female Employee 40th A Game Like Staying At A Love Hotel With Users Who Want To Be Overtaken By A Positive Female Employee! From 20:00 To 6:00, All Through The Night, "King"s Orders Are Absolute"! ! "

  • shinagawa yuzuki shirato remi censoredSDJSsod createremi remi new worldsod female employeeSDJS-196SDJS1961sdjs00196
    • 2023-05-15
    75 min

    498DDH-173 [Shake The Big Pie And Whine Like A Beast! An Unfaithful Wife Who Feels Too Much Blows Away With Her Husband With A Stranger"s Cock] If You Let Her Wife Cuckold With A Senior At The Company... [Minami (34) / Married For 2 Years]

  • amateur censoredbig titsmarried womanddhddh-173ddh173498ddh-173
    • 2023-05-15
    54 min

    NHDTB-51201 Part-time Job Girl Who Feels While Flushing Her Face While Serving Customers 13 Busty Girl At The Car Wash

  • censoredbig titssquirtingNHDTBnatural highitaka smithlin powdernatufileNHDTB-51201NHDTB512011nhdtb51201
    • 2023-05-15
    66 min

    fc2-ppv 3321863 [No Amateur Individual Shooting] Married At The Age Of 22, A New Wife Raising Children Who Has Difficulty Living With Childbirth And Childcare Costs Decides To Appear In AV! The Cool Atmosphere Changes Completely With The Insertion Of

  • amateur uncensoredcreampiemarried woman
    • 2023-05-13
    120 min

    SYKH-076 A Married Woman Who Visits Waisetsu Obstetrics And Gynecology For Infertility Treatment: A Perverted Doctor At A Private Clinic Who Does Anything She Wants, Called Treatment, Vol. 2: Beautiful Married Woman Edition

  • censoredamateurSYKHleisure mrs emanielSYKH-076SYKH076sykh00076
    • 2023-05-13
    113 min

    MRHP-020 When I Was Watching Av At A High Volume, A Beautiful Woman With A Big Butt Who Lives In The House Next Door Rushed In To File A Complaint. A Horny Married Woman Is Horny With My Erect Dick And Sperm It Backwards! I'M Yayoi Zuki With Live Dil

  • mizuki yayoi censoredcreampiesingle workMRHPmrs emmanuelnortonmrs assMRHP-020MRHP020mrhp00020
    • 2023-05-13
    59 min

    fc2-ppv 3316623 God Is The Designer Of This Body! Female Body And Dense S0X Beyond Paris Collection! Miraculous Robbery Completed! ! _ Matoi _ At 23 _ I Cup FC2-PPV-3316623

  • amateur uncensored
    • 2023-05-13
    82 min

    fc2-ppv 3319330 ★Discount Set Sales Vol.6★Providing Popular Works At A Great Price♪The 6th Installment Includes 2 Videos Of Chubby Girls! * High-quality Version & Review Benefits Included ♪ FC2-PPV-3319330

  • amateur uncensored
    • 2023-05-13
    116 min

    KAGP-279 The Naked Picture Book Of An Amateur Girl 30 A Nude Hair Collection For Perverted Gentlemen That Takes A Close Look At How 12 Girls Today Undress While Being Ashamed

  • censoredanalamateurKAGPprincess kaguya pt delusional familywife s trapprincess kaguya ptKAGP-279KAGP279kagp00279
    • 2023-05-13
    74 min

    fc2-ppv 3317482 A Neat And Clean Female College Student Takes Courage And Flirts With Her Uncle At Her First Shot

  • amateur uncensoredcreampieamateur
    • 2023-05-13
    121 min

    TKD-047 Everything That Waited For Us At Minakami Onsen Was Level A Landlady, Hibiki Nakatani

  • nakatani hibiki censoredsingle workTKDrubytakuma rareempireTKD-047TKD047tkd00047
    • 2023-05-12
    120 min

    MIAA-843 Can'T You Use It As An Exercise Bench For Your Aunt? My Sexy Mother-In-Law Works At A Men'S Esthetic Salon, And I'M On The Edge Of A Cliff Of Reason When Erections Are Inevitable... Kobayakawa Reiko

  • kobayakawa reiko censoredcreampieslutMIAAmoody strendy yamaguchieveryone s kikatanMIAA-843MIAA843miaa00843
    • 2023-05-12
    120 min

    MIDV-357 While My Wife Was Traveling Alone And Was Away, My Sister-In-Law Sister-In-Law Sleepover At A Hotel, Adulterous Dates, And I Was Continued To Be Slutty For 24 Hours Mia Nanasawa

  • nanasawa mia censoredslutsingle workMIDVmoody ssapporo taromoodyz divaMIDV-357MIDV357midv00357
    • 2023-05-12
    120 min

    PPPE-118 I Lost My Mind Because Of My Student'S Big Breasts, And I Ended Up Having Creampied Sex With Kaoru Over And Over Again At After School Love-Ho Yasui Kaoru

  • yasui kaoru censoredcreampieschoolgirlPPPEoppaiwakatsukiPPPE-118PPPE118pppe00118
    • 2023-05-12
    120 min

    KAM-130 A Beautiful Girl In A Shoplifting Uniform Creampied By An Unscrupulous Erotic Store Manager At A Convenience Store In Tokyo ● Video Fuyu Ai Kotone

  • toua kotone censoredcreampiebeautiful girlKAMkarmagroupKAM-130KAM130kam00130
    • 2023-05-12
    30 min

    FC2PPV 3312985 [Spring Break Hot Spring Saddle Trip] <Demon Kawa Neat Teens> Leaving The City To A Hot Spring Town! Secretly Blow & Squirting Pussy Twitching Convulsions At A Mixed Bathing Spa ~ 2 Consecutive Irresponsible Vaginal Cum Shots! [

  • amateur uncensoredcreampieamateur
    • 2023-05-12
    63 min

    051223_01 I Taught My NEET Girlfriend Step-by-Step How To Make A Lot Of Money At An Online Auction

  • nozomi kamata uncensoredcreampieamateur
    • 2023-05-12
    140 min

    MUKC-037 You Can Use Your Pussy As Much As You Want At Any Time! Rio Sena Tsuki, The Lewd Recluse Gamer Who Lets You Have Sex Freely While Playing Games

  • natsuki rio censoredcreampiecosplayMUKCinnocentsolid costMUKC-037MUKC037mukc00037
    • 2023-05-12
    120 min

    MIDV-354 As A Homeroom Teacher, I Gave In To The Student'S Temptations And Ended Up Having Sex Over And Over Again At Love Clubs After School... There'S Something New

  • there s a new one censoreduniformsingle workMIDVmoody ssapporo taromoodyz divaMIDV-354MIDV354midv00354
    • 2023-05-12
    54 min

    fc2-ppv 3314018 [*School Barre] I Tricked A Teenage Student I Met At Tsui Tar And Forced Her To Cum Inside Me. A Large Amount Of Semen Spills Beautifully From The Unprocessed Pussy. FC2-PPV-3314018

  • amateur uncensoredcreampie
    • 2023-05-12
    128 min

    FONE-155 Look At That Awesome Ruri! The Damn Cheeky Blond Yankee Girl From The Countryside, Yukapon Is Damn Cheeky, But All The Old Guys Are So Excited About The Tsundere Guckincho That Makes Her Eyes Flutter When It Comes To Sex

  • censoredsquirtingschoolgirlFONEfirst starplus first starFONE-155FONE155h-491fone00155
    • 2023-05-12
    160 min

    JUFE-476 A Plain Big-Breasted Subordinate Who Works At The Town Hall Is Addicted To My (Boss)'S Middle-Aged Big Cock Sex And Is Asked To Do It Anywhere, And Creampied Until She Runs Out Of Sexual Desire Wakamiya Hono

  • honoka wakamiya censoredcreampiesingle workJUFEfitchJUFE-476JUFE476jufe00476
    • 2023-05-12
    190 min

    HJMO-607 Scam Me With An Esthetic Monitor That Is Weak At Pushing! If You Make A Girl With Bumpy Nipples Get Creepy With Aphrodisiac Oil, Is That Crazy!? Shrimp Warped, Convulsed, Incontinence, And Rational Jumping, And Creampied Sex!

  • censoredcreampieHJMOfirst planHJMO-607HJMO607hjmo00607
    • 2023-05-12
    120 min

    MIAA-844 You'Ll Get Better And Better At Pussy Licking! If You Can Do A Good Adult Pussy Training Room In A Space Alone With Popular Av Actress Tenkawa Sora, You'Ll Be Rewarded With Uncensored Cum Shot

  • tenkawa sora censoredslutsingle workMIAAmoody skuri chaneveryone s kikatanMIAA-844MIAA844miaa00844
    • 2023-05-12
    129 min

    420STH-036 KOZU (21) Amateur Hoi Hoi SH / Match App / Brought Home / Breakdown / Let"s Fuck At Home / 21 Years Old / 0 Dating Experiences / Cheerful Character / Curiosity / 2 Shots / Individual Shooting

  • amateur censoredamateurbeautiful girlsthsth-036sth036420sth-036
    • 2023-05-12
    120 min

    PPPE-119 I Had Sex With My H-Cup Older Sister At Work Who Was Depressed Because She Only Had Fights With Her Boyfriend And Got Creampied And Got Cuckold

  • karen kaede censoredcreampiesingle workPPPEoppaiPPPE-119PPPE119pppe00119
    • 2023-05-11
    63 min

    fc2-ppv 3310510 Hokkaido-born H-cup Beautiful Busty Girl! Gachi Huge Breasts! At First, I Was Refused Vaginal Cum Shot, But I Attacked The Portio And She Got Permission To Cum Inside Me (laughs) FC2-PPV-3310510

  • amateur uncensoredcreampieamateur
    • 2023-05-11
    162 min

    AKDL-229 “Let'S Feel Good While Staring At Each Other◆” Kiss-Loving Older Sister'S Flirty Kiss Is On The Verge Of An Explosion!! ~ Makeup Sex Is Also Available ~ Asami Mizuhata

  • mizubata asami censoredslutAKDLaquinoriaquinoriaknrAKDL-229AKDL2291akdl00229
    • 2023-05-11
    270 min

    TUS-117 120 Real Gachi Flirt Legend Vol.117 Thorough Nampa Aiming At Kawasaki"s Big Tits Girl! ! Creampie 120! ! [25 Minutes With Bonus Video Only For MGS]

  • amateur censoredcreampiebig titstustus-117tus117tus-117
    • 2023-05-11
    180 min

    NHDTB-769 A Female Camper Who Couldn'T Help Her Friend Who Was Brought Into The Tent And Was Sent Around 2 At The Same Time

  • censoredNHDTBnatural highraftin maeshiroNHDTB-769NHDTB7691nhdtb00769



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download