aozora




FC2MILKMEYDGMEMGVHSSNIFSDSSPPPDATIDRBDPREDWANZJULMIAAMVSDEBODAUKSSTARSABWAVSAHDKA

2020-12-18
120 min

[SYKH-019]A Sexy Gal Wife Semen-Splattered Raw Creampie Sex Yui-san 24 Years Old

  • censoredcreampiemarried womanSYKHleisure mrs emanielSYKH-019SYKH019sykh00019
    • 2020-12-20
    119 min

    [NNPJ-425]Home Town Country Slut In The Big City. She Came To The Capital To Party, Gets Brought Home By City Boys, Pumped And Dumped! (Wit A Quickie). She's An H-Cup!

  • censoredcreampieNNPJnanpa japanNNPJ-425NNPJ425nnpj00425
    • 2020-12-21
    189 min

    [KSAT-029]Spasmic Married Woman Pussy Orgasms Peeping On Big Vibrator Squirting Masturbation 2

  • censoredsquirtingKSATstrong woman s table daydream tribetable of a strong womanKSAT-029KSAT029ksat00029
    • 2020-12-24
    45 min

    [NYH-077]Horny MILF Trains Her Son's Friends' Eager Young Cocks Miina Wakatsuki

  • miina wakatsuki censoredbig titsmilfNYHdirectorsdirectorsnyanjiang houseNYH-077NYH0771nyh00077
    • 2021-01-04
    48 min

    FC2PPV 1631980 ☆ First shot ☆ Complete appearance ☆ Frustrated beauty OL gave her boyfriend the first Gonzo in Naisho ♥ I shot a lot to the back of the vagina ♪ [With review benefits]

  • amateur uncensoredfc2
    • 2021-01-09
    118 min

    [IPX-596]Sexy Private Tutor Miss Karen's Kissing Lectures - Individual Lesson Karen Kaede

  • karen kaede censoredblowjobsingle workIPXidea pocketdishIPX-596IPX596ipx00596
    • 2021-01-20
    119 min

    [SPZ-1092]Cash For Pics - Beautiful Honor S*****t Is A Secret Slut With Blossoming Tits

  • censoredschoolgirlbeautiful girlSPZstar paradisestar paradiesSPZ-1092SPZ1092h-254spz01092
    • 2021-01-22
    100 min

    [YST-237]My Sister's Obscene Mouth And Greedy Throat Are My Exclusive Mouth Pussies - Saya Minami

  • minami saya censoredcreampiedeepthroatYSTkomyoYST-237YST237540yst00237
    • 2021-01-23
    136 min

    [JUL-448]Gorgeous, Voluptuous Co-Stars! Your Sweaty Stepsisters Want To Share Their Colossal Tits With You And Take Your Creampie In A Three-Some Rin Okae Hana Haruna

  • rin okae haruna hana censoredcreampiebig titsJULmadonnamametaro mamezawaJUL-448JUL448jul00448
    • 2021-01-30
    68 min

    326KNTR-002 [Cuckold Immediately NN Bulletin] A metamorphosis gal who is jealous and estrus cums many times with an actor Ji Po ☆ I am crazy with an unfaithful act begging for pregnancy juice! !!

  • amateur censoredcreampieamateurkntrkntr-002kntr002326kntr-002
    • 2021-02-05
    241 min

    [BUR-564]Risky Business! How In The World Did I End Up Getting Made To Fuck？! Extreme Rough Sex Leaked Footage 4 Hours

  • censoredcreampiebeautiful girlBURglay zburst graceBUR-564BUR56412bur00564
    • 2021-02-12
    157 min

    [MKMP-381]The Big Tits Female Doctor Counseling Room, Where These Ladies Use Their Dirty Bodies To Drive Men Wild Riho Fujimori Mao Hamasaki Tsubasa Hachino

  • riho fujimori yano tsubasa censoredbig titsslutMKMPk m producegory matsutamillionMKMP-381MKMP38184mkmp00381
    • 2021-02-13
    48 min

    H4610 ori1748 Saaya Nagato 20years old

  • amateur uncensoredh4610
    • 2021-02-19
    115 min

    [EVIS-336]Old Fashioned Lesbian Public Bath Run By 4 Beautiful Sisters

  • is it igarashi censoredlesbianEVISebisusan mousouzokubyakkoEVIS-336EVIS336evis00336
    • 2021-02-20
    54 min

    324SRTD-0213 A female student who hasn’t bloomed yet but can get a glimpse of the de M

  • amateur censoreduniformamateursrtdsrtd-0213srtd0213324srtd-0213
    • 2021-02-21
    144 min

    [JUL-478]I Lost My Comppany And My Wife. The President's Wife Cuckold Maki Tomoda

  • maki tomoda censoredbig titsmature womanJULmadonnajo styleJUL-478JUL478jul00478
    • 2021-02-25
    78 min

    435MFC-084 [Shiroto Gonzo] Gonzo with a super cute girl with maximum female power / Sakura / 24 years old / C cup

  • amateur censoredcreampieamateurmfcmfc-084mfc084435mfc-084
    • 2021-02-26
    59 min

    FC2PPV 1697114 [Personal shooting] Nanase 24 years old, mass firing on shaved nice ass slender black gal with outstanding sensitivity

  • amateur uncensoredfc2
    • 2021-03-11
    102 min

    [SPRD-1388]Forgive Me... I Want My Son-in-law's Baby - Rieko Hiraoka

  • rieko hiraoka censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1388SPRD138818sprd01388
    • 2021-03-12
    47 min

    FC2PPV 1686765 First shot ❤️ Former reader model Shiori Ito 26 years old ❤️ There is a purchase privilege with two singles recruited on Twitter and a nasty orgy

  • amateur uncensoredfc2
    • 2021-03-13
    119 min

    [EBOD-806]Cute Part-Timer With Big Tits And A Ponytail Succumbs To The Pleasure Of Her Mean Manager's Mating Press. Karen Yuzuriha

  • karen kaede censoredcreampiebig titsEBODe bodytrendy yamaguchiEBOD-806EBOD806ebod00806
    • 2021-03-30
    51 min

    C0930 ki210330 Satomi Miyake 40years old

  • amateur uncensoredc0930
    • 2021-04-01
    121 min

    [AMBI-123]Perverted Step Dad's Sex Toy Beautiful Y********l In Uniform Has Her Relationship With Her Boyfriend Ruined Suzu Monami

  • monami bell censoreduniformschoolgirlAMBIplanet plusdirector oanbibaresotsuAMBI-123AMBI123h-237ambi00123
    • 2021-04-28
    117 min

    374IMGN-011 Yuhi (33)

  • amateur censoredmarried womanamateurimgnimgn-011imgn011374imgn-011
    • 2021-05-06
    297 min

    [AKDL-108]An Amateur Babe I Met On Thursday 3 (Faces Revealed / Sex During Office Hours / Pussy Stains / POV / She Has A Boyfriend / Superior Big Tits)

  • censoredbig titsamateurAKDLaquinoriaquinoriaknrAKDL-108AKDL1081akdl00108
    • 2021-05-08
    151 min

    [APKH-173]When I Messaged The Secret Account Of A Beautiful Rich Married Woman (27 Years Old) She Immediately Agreed To Fuck Me! Filming Hot And Steamy Sex With A Slutty Adulterous Wife Wearing A Thong Mia Hanesaki

  • mia hasaki censoredcreampieblowjobAPKHaurora project annexhaurora project anexAPKH-173APKH173apkh00173
    • 2021-06-11
    156 min

    [JUFE-294]My Very Own Convenient Sucking Pet: Compliant, Soft Maid College Girl With Colossal Tits Edition - Reina Toen

  • reina taoyuan censoredcreampiebig titsJUFEfitchJUFE-294JUFE294jufe00294
    • 2021-06-16
    240 min

    [OOMN-272]Natural Beautiful Titties Big Tits Shake And Bounce As She Cums Like Crazy And Has Sex 7 Times Nene Tanaka BEST

  • nene tanaka censoredbig titssingle workOOMNabc mousouzokuokasan.comOOMN-272OOMN272oomn00272
    • 2021-06-18
    66 min

    SIRO-4480 [First shot] [God-friendly idol smile] [Innocent and plump round butt] A baby-faced beautiful girl college student who also has experience as an underground idol. An innocent smile turns into an obscene crying face, and a small body full of

  • amateur censoredamateursirosiro-4480siro4480siro-4480
    • 2021-06-23
    55 min

    FC2PPV 1884077 ★ First shot amateur ☆ Bombshell huge breasts dynamite body ♥ Devil’s mature wife aiming for another stick ♥ Tomoko 36 years old ☆ Exciting vacuum blowjob ♥ Unstoppable libido ♥ Continuous Iki’s intense squirrel is a great wo

  • amateur uncensoredfc2
    • 2021-07-02
    62 min

    FC2PPV 1899001 [No] 19-year-old JD beautiful girl, anal virgin SEX … Life’s first AF & creampie

  • amateur uncensoredfc2
    • 2021-07-09
    170 min

    [EBOD-844]This nurse from Tohoku with a soothing smile and an ample J cup who kindly takes care of grandad as well as cocks makes her AV debut. Q: Why do girls with big boobs look so friendly？ A: Because big boobs make them look maternal. An Ayumi

  • ayumi an censoredbig titssingle workEBODe bodylamb chopEBOD-844EBOD844ebod00844
    • 2021-07-18
    67 min

    FC2PPV 1929135 I Fell In Love With An 18-Year-Old Lady And Tried Gonzo

  • amateur uncensoredfc2
    • 2021-08-13
    119 min

    [SSIS-146]I Indulged In Matchless Sex With My Neighbor The Office Worker Who Moved In Across The Street. Aika Yumeno

  • yumeno aika censoredbig titssingle workSSISs1 no 1 styletaiga kosakaiSSIS-146SSIS146ssis00146
    • 2021-08-19
    77 min

    [REBD-579]Mayuki4: Mayukichi * Syndrome - Mayuki Ito

  • maiyuki ito censoredsingle workREBDrebeccaherpes takaREBD-579REBD579h-346rebd00579
    • 2021-08-21
    135 min

    [CEAD-358]I Am A Really Slutty Masturbator Who Is A Pleasure Fanatic, No. 19. Sakura Tsuji.

  • sakura tsuji censoredbig titsmature womanCEADcelebrity friendsCEAD-358CEAD358cead00358
    • 2021-09-03
    157 min

    [CAWD-279]Sexual Healing Massage Where They Smile Big And Whisper Calmly To Guide You To Many Deep Orgasms, Natsu Hinata

  • natsu hinata censoredbeautiful girlhandjobCAWDkawaiilamb chopCAWD-279CAWD279cawd00279
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-12
    69 min

    300NTK-633 [Special Grade Beautiful Girl] [Extra Fine Body] [Surprise Raw Fitting 2nn] Super Extreme Shikohame Shooting Where The Ultra Fine Body Of A Facial Reveti God Beautiful Girl Trembles And Feels Warped! !! I Feel Like I’m Having Fun With

  • amateur censoredcreampieamateurntkntk-633ntk633300ntk-633
    • 2021-09-23
    61 min

    H4610 ki210923 Yuka Sakura 26years old

  • amateur uncensoredh4610
    • 2021-09-24
    100 min

    [YST-255]My Father-In-Law Using Me As A Mouth-Pussy, But I"m A Pervert And Love It. Aya Shiomi

  • aya shiomi censoredcreampiedeepthroatYSTkoyachoYST-255YST255540yst00255
    • 2021-10-11
    40 min

    [SHH-029]Barely Legal Masochist Wants To Get Pounded Hard Watch Her Skip The Foreplay At The Hot Spring Hotel She"s Already Touched Herself Into A Sexual Frenzy, And Now Longs To Be Creampied Again And Again

  • censoredcreampieSHHnatural hightanaka baconSHH-029SHH0291shh00029
    • 2021-10-12
    48 min

    H4610 ki211012 Tomoyo Mizushima 26years old

  • amateur uncensoredh4610
    • 2021-10-28
    195 min

    [ABW-159]超！透け透けスケベ学園 CLASS 13 美しい裸身が透き通る、透けフェチ特濃SEX！ 八掛うみ【MGSだけのおまけ映像付き 25分】

  • amateur censoredsquirtingamateurabwabw-159abw159abw-159
    • 2021-11-05
    120 min

    [SSIS-232]Close-up Living With The World"s Best Girlfriend "Anzai Lala" And Her Godly Tits

  • anzai rara censoredbig titssingle workSSISs1 no 1 stylefamSSIS-232SSIS232ssis00232
    • 2021-11-12
    153 min

    [MIAA-527]A Big Tits Personal Trainer After A Workout At The Gym, It"s Time To Share A Room For Some Creampie Adultery These Finely Honed Muscular Bodies Are Banging Each Other Hard And After A Creampie Fuck Fest, They"ll Get Together For Org

  • mina kitano censoredcreampiebig titsMIAAmoodyzhata tairyouminna no kikatanMIAA-527MIAA527miaa00527
    • 2021-11-26
    101 min

    [YST-260]My Step-Father, who Married My Beloved Mother, was a Guy Who Loved Rough Sex. Mitsuki Nagisa

  • scooping censoredcreampiesingle workYSTkoyachoYST-260YST260540yst00260
    • 2021-12-03
    240 min

    [MIDV-009]This Divine Titty Yo*Tu*e* Is Still In Action Her Pussy Is Getting Pumped Full Of Throbbing, Spasmic, Follow-Up Thrusts And Making Her Cum Like Crazy! 4 Fucks Mirai Asumi

  • yuna miyazawa miu natsume miu harukawa lisa natsume iori censoredbeautiful girlMIDVmoodyzusapyonmoodyz divaMIDV-009MIDV00948midv00009



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download