angel moe




FC2VENUONEZMEYDHDKAGMEMSANSHKDADNATIDCAWDAPODDTTIPXMILKCHRVHODVHUNTBNATRNACRBLK

2020-09-03
63 min

HEYZO 2345 Deep Kiss, Furious Sex -Make Me Cum With Passionate Kiss- – Yuka Sayama

  • yuka sayama uncensoredcreampieheyzo
    • 2020-09-03
    70 min

    396BIG-083 Erina part2

  • amateur censoredcreampiesquirtingbigbig-083big083396big-083
    • 2020-09-05
    63 min

    H4610 ki200906 Keiko Okuyama 27years old

  • amateur uncensoredh4610
    • 2020-09-20
    149 min

    [CAWD-117]Unstoppable Squirting Climax! Yui Amane's First Orgasm! First Time Sensual Body Nonstop Throbbing 3 Fucks!!

  • amane yui censoredsquirtingbeautiful girlCAWDkawaiimichiru arashiyamaCAWD-117CAWD117cawd00117
    • 2020-09-21
    76 min

    259LUXU-1314 Luxury TV 1303 The second appearance of a plump glamorous beauty who is no longer satisfied with private sex! Overwhelming milk pressure! The appearance of twisting a glamorous body with outstanding destructive power and climaxing many t

  • amateur censoredbig titsamateurluxuluxu-1314luxu1314259luxu-1314
    • 2020-09-26
    158 min

    [WANZ-987]"What？ You Just Came Inside Me？" Guy Tells A Girl He Already Blew His Load So She Lets Him Keep Thrusting - Until He Gives Her A Creampie! Rika Tsubaki

  • tsubaki rika censoredcreampiebig titsWANZwanz factorywanzWANZ-987WANZ987wanz00987
    • 2020-09-27
    168 min

    [YAKO-016]A Legendary Nampa Pickup Artist Presents The 3 Best Beautiful Girl Babes He's Ever Fucked In His Life, Now For The First Time On DVD

  • censoredcreampiebig titsYAKOmercuryshinjuku undergroundYAKO-016YAKO016h-1133yako00016
    • 2020-10-04
    61 min

    413INST-058 G-Cup God Milk Dollar Kokoro-chan 19 years old ☆ Finally capture that legendary active Gravure-chan! After all face, bust, style are all god level ☆ There is no rubber in the defenseless uterus that arrives at the house.

  • amateur censoredbig titsamateurinstinst-058inst058413inst-058
    • 2020-10-09
    55 min

    345SIMM-526 [K cup] Big breasts (116 cm) x tall (168 cm) Glamorous BODY swaying meat bullet FUCK [suit & tiny bikini]

  • ykol censoredbig titsamateursimmsimm-526simm526345simm-526
    • 2020-11-13
    51 min

    FC2PPV 1568379 [Personal shooting] The last lust sex before the affair breaks up with her! The relationship between the two who burns indecently, I have vaginal cum shot without thinking ahead! [Appearance]

  • amateur uncensoredfc2
    • 2020-11-13
    149 min

    [SCPX-411]They Call Me The Guy That Lives In The Room... A Mom And Younger Sister Do What I Tell Them

  • censoredcreampiebig titsSCPXscoophasshimousouzokuSCPX-411SCPX411h-565scpx00411
    • 2020-11-15

    FC2PPV 1570791 Limited number [None] 172cm slender girl with experience of winning a beauty pageant, inn private room open-air bath continuous vaginal cum shot (59 minutes)

  • amateur uncensoredfc2
    • 2020-11-23
    118 min

    [XVSR-564]Sensual Drama: Even Though He's S******g Right Next To Us... NTR Sex While Keeping Quiet To Not Be Found Out Mao Kurata

  • kurata mao censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-564XVSR564xvsr00564
    • 2020-11-26
    133 min

    [MOND-203]I'm With My Favorite Lady Boss Kasumi Ikeya

  • kazumi ikeya censoredmature womansingle workMONDtakara eizohotate ikkandaiichi housouMOND-203MOND20318mond00203
    • 2020-11-27
    97 min

    FC2PPV 1585277 [End of no sale] Super deals! Large volume for a total of 3 hours! !! Masturbation, Blow-free pack + 1 piece of work in storage [Personal shooting]

  • amateur uncensoredfc2
    • 2020-11-27
    151 min

    [BOKD-204]AV Debut: I Might Look Like This, But I Have A Dick You Know. Nanami Shiraishi

  • nanami shiraishi censoredcreampiesingle workBOKDwe re she malesdorikawaBOKD-204BOKD204h-995bokd00204
    • 2020-11-28
    60 min

    FC2PPV 1586923 ★ Super hot 3P ☆ Creampie orgy with two best daughters ♥ Miya-chan & Yukino-chan ☆ Two bewitching rich lesbian play ♥ Dangerous W Blow blame ♥ Blame and finally cum shot ♥ [Individual Shooting] * With benefits

  • amateur uncensoredfc2
    • 2020-12-04
    201 min

    [ABW-031]An Erotic And Cute Country Slang Situation Vol.02 Kansai Dialect Hakata Dialect Tohoku Dialect Kyoto Dialect Airi Suzumura

  • suzumura airi censoredsquirtingblowjobABWprestigetsuruhashiabsolutely wonderfulABW-031ABW031118abw00031
    • 2020-12-06
    94 min

    [VENU-982]"They Barely Fit In Here" Sex In The Bath With My Busty Mother-In-Law Rika Tsubaki

  • tsubaki rika censoredcreampiebig titsVENUvenussarufakecest winntersVENU-982VENU982venu00982
    • 2020-12-10
    76 min

    FC2PPV 1601240 [Hidden shooting] Blindfolded handcuffs sex with a 19-year-old slender metamorphosis amateur girl! There is a second round [Personal shooting of support [No.44]] [Review privilege: Another angle]

  • amateur uncensoredfc2
    • 2020-12-18
    100 min

    [VENU-988]Plump, Perky, And Glistening! Your Stepmom Looks Sexy In Body Suits Rena Asami

  • asami rena censoredcreampiemarried womanVENUvenuskanyeincestVENU-988VENU988venu00988
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-17
    120 min

    [BST-018]Single Girl's Trip Hunting Cherry Boys - Haruka Aisawa

  • censoredamateurBSTrubysuke kato 6boston bagBST-018BST018118bst00018
    • 2021-01-30
    61 min

    Caribbeancom 013021-001 Special Boobs SEX For Boobs Fetish Airi Mikumo

  • airi mikumo uncensoredcreampiehandjobcaribbeancom
    • 2021-01-30
    118 min

    [MIAA-387]All I Did Was Drop My Underwear, And This Is What Happened... All The Men In The Apartment Building Mistakenly Assumed That She Was Luring Them To Temptation, And So They All Came And Fucked Her In A G*******g Fuck Fest Rei Kuruki

  • satoshi kuruki censoredcreampiesquirtingMIAAmoodyzkitorune kawaguchieveryone s porn starMIAA-387MIAA387miaa00387
    • 2021-02-28
    55 min

    FC2PPV 1705625 [First shot! ] Immediately like through a mask! I ●● Tafollower ● Blame all the beautiful women with that hand www

  • amateur uncensoredfc2
    • 2021-03-02
    161 min

    1Pondo 030221_001 Kurumi Kokoro : Kurumi Kokoro Special Edition

  • amateur uncensored1pondo
    • 2021-04-14
    119 min

    [OKSN-329]New Discovery! Adorable Pale-Skinned Beauty Can't Resist Her Lust For Her Lover - Drowning In Forbidden, Adulterous Passions

  • censoredbeautiful girlOKSNabc mousouzokuokaasan.com abc daydream familyOKSN-329OKSN329oksn00329
    • 2021-04-23
    117 min

    300NTK-557 Happy Bitch GAL participates in W! !! Facial deviation value Revechi Bishoujo JD’s active uniform photo session! !! Just take a gal of sexual desire like a wild beast! ？？ "Takayaru？" Happy invitation & Kamijiri Binkan BODY

  • amateur censoredcreampieamateurntkntk-557ntk557300ntk-557
    • 2021-04-29
    130 min

    [278GNAB-055]性欲モンスター級！！デカ尻介護士に種搾りプレスで性処理専用の肉バイブにされた話

  • amateur censoredamateurslutgnabgnab-055gnab055278gnab-055
    • 2021-04-29
    64 min

    413INST-117 Be careful of danger because it is too sharp. K cup huge breasts OLx2 [Beauty style awakened to sex ♀] Orgy virgin is <crazy> continuous acme. The naive beauty is "Uuu Ugimo", jumping with her and climax and seeding completed

  • amateur censoredcreampiebig titsinstinst-117inst117413inst-117
    • 2021-04-30
    257 min

    [HEZ-275]Street Pick Up Of First Class Hot Celeb Mature Chick w/ Creampie Finish 29

  • censoredcreampiebig titsHEZhot entertainmentstudio zerohot premium rose docuHEZ-275HEZ27559hez00275
    • 2021-05-01
    189 min

    [BBAN-324]Female Teacher Lesbian Sex Servant H

  • yuri sasahara chiharu miyazawa censoredlesbianbdsmBBANbibianBBAN-324BBAN324bban00324
    • 2021-05-19
    37 min

    FC2PPV 1826072 [No] [Limited to 100 pieces 2980 → OFF to 1480pt!] The long-awaited sequel to a beautiful beauty who is too beautiful ♥ ️ I’m doing something more erotic than the previous work! * Review benefits / Shivering ♥ Denma masturbation ♥

  • amateur uncensoredfc2
    • 2021-06-02
    79 min

    259LUXU-1433 Luxury TV 1412 "I want to be embraced by an actor …" A beautiful ballet instructor makes a long-awaited AV appearance! Climax many times while shaking the slender body that is too sensitive, and get drunk with the approachin

  • amateur censoredamateurluxuluxu-1433luxu1433259luxu-1433
    • 2021-06-14
    72 min

    491TKWA-002 Tsugumi

  • amateur censoredcreampiebig titstkwatkwa-002tkwa002491tkwa-002
    • 2021-06-16
    60 min

    444KING-038 Marie

  • amateur censoredcreampiesquirtingkingking-038king038444king-038
    • 2021-06-23
    58 min

    404DHT-0210 Anything can be done! Big Breasts Mature Woman Explodes Yaruki Sakura 41 Years Old

  • amateur censoredbig titsmarried womandhtdht-0210dht0210404dht-0210
    • 2021-07-02
    180 min

    [SSIS-110]Celebrity's Latent Libido Explodes To The Surface! 180 Minutes Of Extreme Orgasms, 4 Full Fucks Riri Nanatsumori

  • nanatsumori riri censoredsquirtingsingle workSSISs1 no 1 stylemon cSSIS-110SSIS110ssis00110
    • 2021-07-10
    130 min

    [AVSA-172]SUPER FISHEYE FETISHISM Voluptuous Nympho Nurse's Thick Curves Honami Akagi

  • honami akagi censoredbig titssingle workAVSAavs collector sbuddha davscollector sAVSA-172AVSA172avsa00172
    • 2021-07-15
    239 min

    [TIKB-117]Amateur "Onikawa" Girl's Personal Photography * Extreme Lewdness * Big Ass * Gal * POV

  • satoshi kuruki natsu tojo censoredcreampiebig titsTIKBtikitiki.comerTIKB-117TIKB117tikb00117
    • 2021-07-22
    122 min

    [FSDSS-256]FALENO Members Only This Soapland Provides National Treasure-Class Service Minamo Nagase

  • minase nagase censoredbig titsblowjobFSDSSfalenoboomer 44faleno starFSDSS-256FSDSS2561fsdss00256
    • 2021-08-20
    180 min

    [OFKU-188]The Stepmother Who Had A Fight With Her Husband And Came Over To Stay At Her Stepson"s Apartment... 180 Minutes

  • censoredcreampieOFKUstar paradiseofukuro tetsudouOFKU-188OFKU188h-254ofku00188
    • 2021-09-02
    15 min

    FC2PPV 2130911 [Individual Shooting] Metropolitan Handicraft Club ② G Cup Long Black Hair And Glaring Sex Gonzo Unavoidably For 〇

  • amateur uncensoredfc2
    • 2021-10-01
    160 min

    [DVDMS-720]General Male/Female Monitoring Collaboration Variety Beautiful Cabin Attendant Experiences First Cumshot In Black Pantyhose! 3 CA"s Who Were Fondled Continuously Leaked Cum Onto Their Pantyhose...

  • censoredsquirtingamateurDVDMSdeepspoolsideDVDMS-720DVDMS720dvdms00720
    • 2021-10-01
    63 min

    328HMDN-412 [Azato Kawaii] A 25-Year-Old Newly-Married Married Woman Who Eats A Man In A Dating (Active Voice Actor !!) Individual Shooting Video That Has Been Fully Seeded In A Plump Hairless Pussy [Gonzo] (Maina Yuuri)

  • amateur censoredcreampiebig titshmdnhmdn-412hmdn412328hmdn-412
    • 2021-10-02
    160 min

    [LULU-098]A Socially Awkward Shut-in That"s Never Left His Parents" Home Loves Tits And Has A Big Dick That Gets Worked Over Non-stop By A Super Long Tongue. Honoka Tsujii

  • tsujii honoka censoredbig titsblowjobLULUlunaticsvragmanLULU-098LULU098lulu00098
    • 2021-10-22
    118 min

    [ROE-015]SNS Encounters: My Week Of Getting Drained By A Married Mama Who Just Wants A Baby. Isshiki Momoko

  • momoko isshiki censoredbig titsmature womanROEmadonnakimura hiroyukimonroeROE-015ROE015roe00015



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download