anal jav squirting high vision censored




FC2HMNPPPDWANZATIDSHKDSPRDMIDEADNFSDSSMVSDKSBJSSISSDABHNDWAAAAPODEBODSQTEBLKNGOD

2020-10-23
85 min

[FTHT-005][Squirting Dancer From The Ryukyu Archipelago] Delivering Boxed Lunches With Her Delicate Body Flying In The Air! Pussy Collapse! Uncontrollable Leakage, Squirting And All Wet In A Loop! Screaming Out As She Is Piston Fucked Repeatedly By B

  • censoredcreampiesquirtingFTHTfalenodavielfalenotubeFTHT-005FTHT0051ftht00005
    • 2020-10-27
    152 min

    [HONB-193]Don't Look At Me! I'm Going To Cum! Beauty Parlor S*****t (# ^^ #)

  • censoredcreampieHONBmercurythe first shibuya special f e headquarHONB-193HONB193h-1133honb00193
    • 2020-11-15
    62 min

    SIRO-4337 [First shot] [Lady raised in girls’school] [Obscene study session] After school in autumn when a serious lady raised in girls’ school is disturbed and panting. A nasty foolery that a beautiful girl who becomes bold fascinates. App

  • amateur censoredamateursirosiro-4337siro4337siro-4337
    • 2020-11-25
    57 min

    [orec-632]ひかりさん

  • amateur censoredamateurorecorec-632orec632orec-632
    • 2020-11-27
    42 min

    [CLO-100]Gentle Titjob Cumshots Yuri Honma

  • really censoredbig titsblowjobCLOchobitchchovicCLO-100CLO100h-1435clo00100
    • 2020-11-29
    124 min

    [EMBZ-215](Caution Before Viewing) G*******ging Sex Videos Uncut And Unedited A Video Record Of Bitches Getting Fucked No Mercy! These Married Woman Babes Were Primed With Aphrodisiacs, And Went Cum Crazy For Infinite Creampies And Had Their Cunts An

  • asano censoredcreampiemature womanEMBZjukujojuku emmanuellejukujo jukuEMBZ-215EMBZ215embz00215
    • 2020-12-02

    FC2PPV 1592219 Limited [No] Supporting the egg of a voice actor who came to Tokyo for a dream, continuous vaginal cum shot (47 minutes)

  • amateur uncensoredfc2
    • 2020-12-27
    60 min

    C0930 ki210101 Kazumi Miyata 34years old

  • amateur uncensoredc0930
    • 2021-01-08
    29 min

    [BTH-106]You'll Want To Give Her A Facial Mio Kimijima

  • kimishima mio censoredbukkakeBTHchobitchchovicBTH-106BTH106h-1435bth00106
    • 2021-01-09
    118 min

    [MIAA-373]Countryside Homestay Seduction Hikari Sena

  • hikari sena censoredbig titssingle workMIAAmoodyzzaku araieveryone s porn starMIAA-373MIAA373miaa00373
    • 2021-01-16
    153 min

    [MVSD-453]She's Lifting Her Anal Ban For Her First And Absolute Best Anal Fuck It's Been Awhile Since You've Got To Butt Fuck, And Now This Maso Bitch Is Shaking Her Colossal Tits With Orgasmic Pleasure! Hear Her Scream! She's Shaking

  • yoshine yuria censoredbig titsdeepthroatMVSDm s video grouptetsuya taniwatashiMVSD-453MVSD453mvsd00453
    • 2021-01-23
    136 min

    [CAWD-164]Working Overtime With My Legs Open... Bred By My Boss... Moko Sakura

  • sakura moko censoredcreampiesingle workCAWDkawaiihiroyuki kimuraCAWD-164CAWD164cawd00164
    • 2021-02-01
    64 min

    SIRO-4391 [First shot] [Sensitive gal trembling jerky] [Athlete body] Youthful blonde gal participates in the war! !! The body that is too sensitive is rolled up many times with a penis .. AV application on the net → AV experience shooting 1454

  • amateur censoredamateursirosiro-4391siro4391siro-4391
    • 2021-02-02
    140 min

    [MSFH-049]Slick, Sweaty Bodies Slippery With Sex Fluids Konomi Yoshinaga

  • konomi yoshinaga censoredsquirtingsingle workMSFHsod createkyoseims sodMSFH-049MSFH0491msfh00049
    • 2021-02-11
    135 min

    [IENF-124]Amateur Pick Ups - Tiny Girls We Spotted In Aoyama Take Massive Cocks - She Offered A Thigh Fuck, But What If She Got Horny Enough To Spread Her Legs.

  • censoredcreampieamateurIENFienergytiger kosakaiienfIENF-124IENF1241ienf00124
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-28
    120 min

    [KSBJ-120]Tempted By My Son's Wife - Hoshina Kanenashi

  • hoshino censoredcreampieblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-120KSBJ120ksbj00120
    • 2021-03-06
    150 min

    [PRED-292]Slender Straddling - This Cute Sisterly Girl And Her Bouncy Ass Wants To Get Sluttier - Mami Sakurai

  • mami sakurai censoredslutsingle workPREDpremiumtrendy yamaguchielegancePRED-292PRED292pred00292
    • 2021-03-11
    93 min

    [OKK-024]Slick, Sweaty, Intimate Sex In A Nut-Busting Competitive Swimsuit - Mitsuha Higuchi - Enjoy This Tiny Teen At Her Wettest! Hidden Camera Voyeur Footage From The Change Room - From Tiny Boobs To Big Tits, Shaved Pussy, Hairy Snatches, And Arm

  • mitsuha higuchi censoredbeautiful girlsingle workOKKdaddy s private photosgodly swimming raceOKK-024OKK0241okk00024
    • 2021-03-19
    136 min

    [KAGN-003](A Private Video Session) A Blowjob, Anytime, Anywhere 2 11 Ladies

  • censoredamateurblowjobKAGNkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGN-003KAGN003kagn00003
    • 2021-03-20
    68 min

    476MLA-015 The figure body with outstanding style is continuously ○! !! Astonished at the masterpiece cowgirl of a neat and clean bitch caught by a diet monitor bite ww

  • amateur censoredcreampieamateurmlamla-015mla015476mla-015
    • 2021-03-21
    119 min

    [JUL-513]Raw Sex With A Married Maid Who Will Do Whatever You Want

  • karen sasahara censoredcreampiemature womanJULmadonnarokusaburo mishimaJUL-513JUL513jul00513
    • 2021-03-26
    125 min

    374IMGN-007 Ranran-chan

  • amateur censoredamateurbeautiful girlimgnimgn-007imgn007374imgn-007
    • 2021-03-29
    52 min

    292MY-427 Amina Sakashita

  • amateur censoredmarried womanamateurmymy-427my427292my-427
    • 2021-04-03
    127 min

    [SORA-305]"Look At My Shameful Body" Perverted Masochistic Slut Is Open For Business! Momo Hazuki

  • hazuki peach censoredsingle workSORAyama to soratrippyySORA-305SORA305sora00305
    • 2021-04-09
    137 min

    [MKMP-393]I've Been Getting Fucked Raw By My NEET Step Brother At Home Every Day Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsMKMPk m producegory matsutamillionMKMP-393MKMP393mkmp00393
    • 2021-04-10
    60 min

    H0930 ki210411 Junko Tsukahara 37years old

  • amateur uncensoredh0930
    • 2021-04-12
    96 min

    [DORI-017]Sex Tape No.17 "I Could Feel It Throbbing Somewhere In The Middle ..." This Bad Girl J* Was Twitching And Trembling While She Came And I Creampie Fucked Her Twice Without Permission, And Then She Said, "Well, It Did Feel Really

  • censoredcreampieuniformDORIfirst starsucking shootingDORI-017DORI017h-491dori00017
    • 2021-04-15
    122 min

    [ZEX-403]*Warning* To The Brink Of Breaking! Super Intense Begging For Climax Sex Hono Wakamiya

  • honoka wakamiya censoredbig titssingle workZEXpeters maxZEX-403ZEX403h-720zex00403
    • 2021-05-22
    47 min

    H4610 ki210522 Chikako Hamano

  • amateur uncensoredh4610
    • 2021-05-25
    53 min

    C0930 ki210525 Kiyomi Inui 45years old

  • amateur uncensoredc0930
    • 2021-06-01
    182 min

    [STARS-371]MINAMO Super Huge, Fresh Face AV DEBUT [Get Off In This Staggering 4K Video!]

  • minamo censoredbeautiful girlsingle workSTARSsod createhideyuki shinboSTARS-371STARS3711stars00371
    • 2021-06-07
    63 min

    SIRO-4511 [First shot] [Lady’s plump beauty big tits] [Shameful cum] Beautiful big tits junior high school teacher who does not feel age. A hungry single mother is disturbed by exposing her face to the dense sexual intercourse that children and

  • amateur censoredamateurmature womansirosiro-4511siro4511siro-4511
    • 2021-06-11
    55 min

    FC2PPV 1864013 [Sweet drink] That modern girl finally participates in the war. Cum Circle 13

  • amateur uncensoredfc2
    • 2021-07-01
    61 min

    324SRTD-0235 Dirty Mom Who Wants Saffle Sperm Even Though She Has Just Born

  • amateur censoredcreampiebig titssrtdsrtd-0235srtd0235324srtd-0235
    • 2021-07-02
    125 min

    [ARM-994]Erotic Ass: Anal Showing Cowgirl

  • ayaka muto hanaoto urara censoredanalslutARMaroma planningmania satoshiaromaARM-994ARM994arm00994
    • 2021-07-10
    299 min

    [DVAJ-525]My Wife Started Telling Me About Her Adultery, and Now I Have an Erection That Won't Stop... Making Her Apologize While Disciplining Her Unfaithful Body was the BEST Story

  • kawakami nanami shinoda yu censoredcreampieDVAJalice japansagi kandaDVAJ-525DVAJ525dvaj00525
    • 2021-07-27
    240 min

    [SDAB-190]Developing Body, Uncertain Beautiful Girl 18 Years Old SOD Exclusive AV Debut Rin Momono [Get Off To Impressive 4K Video!]

  • rin momono censoredbeautiful girlSDABsod createSDAB-190SDAB190
    • 2021-07-28
    85 min

    428SUKE-081 [Yukata + Aphrodisiac Flood Sex! ？？ ] Borrow A Mobile Battery And Get Tipsy Yukata Beauty And Pakopako Sp! !! I Can’T Wait To Get To The Hotel, And I Can’T Wait To Blame The Tongue By Car. Fujiyama Splash Dalian Buchi Rise Www [

  • amateur censoredcreampieamateursukesuke-081suke081428suke-081
    • 2021-08-07
    91 min

    [ANX-136]A Strong Addiction To Being Not Quite Yourself: Her Territory - A New Area. Maina Yuuri.

  • yuuri censoredbig titscosplayANXsaimin kenkyuusho bekkansainansaimin rei onna saimin kenkyuusho bekkanANX-136ANX136anx00136
    • 2021-08-21
    98 min

    300NTK-625 [Asia No.1 Yariman Slender & G Breast Boyne Beauty JD Duo And Greedy Set 4p Special! !! ] Slender International Students Are Hidden Nerds And Dovich Beautiful Girls! !! Two Consecutive Vaginal Cum Shots For The First Time In Japan With

  • amateur censoredcreampieamateurntkntk-625ntk625300ntk-625
    • 2021-08-26
    122 min

    [FSDSS-273]Girl Who Fucks Too Much Gives Blowjob To Housemates Rin Natsuki

  • rin natsuki censoredbig titsblowjobFSDSSfalenomaeda satoshifaleno starFSDSS-273FSDSS2731fsdss00273
    • 2021-09-03
    281 min

    [DVDMS-693]Sex-loving Step-sisters Who Love Raw Sex And Want You To Lick Their Pussies

  • momose asuka mamiya nagi censoredcreampieslutDVDMSdeepsmotofuji peroflavorsDVDMS-693DVDMS693dvdms00693
    • 2021-09-09
    102 min

    FC2PPV 2181690 [9980 → 9/11 2980] [Complete Appearance] 22-Year-Old G Cup Neat Lady Nursing Student ❤️ I Really Had Such A Daughter ❤️ Real Erotic Cartoon Girl Without Acting ❤️ The World’S Best Ahegao ❤️ Whole Body Continuous Acme Cum Shot ❤️

  • amateur uncensoredfc2
    • 2021-09-21
    100 min

    FC2PPV 2228861 [Retirement Work] The Last Work Is Released With A Boyfriend Barre ♪ Gachimuchi G Cup Megumi Body Small Face Beauty Crying Face Acme ♪! Limited Number Of Sanku-Chan Chapter 5_retirement Work

  • amateur uncensoredfc2
    • 2021-10-08
    134 min

    [BBAN-346]Sweat-Filled Lesbian Series of Beautifully Performed Sex. Noa Eikawa, Aoi Kururugi

  • sakaegawa noa aoi kururugi censoredlesbianBBANbibianyurukoBBAN-346BBAN346bban00346
    • 2021-10-23
    153 min

    [CEMD-072]Fucking, Confusion! Lover Hot Devil"s Fuck Trip! Nanao Nakano -Woman Fucks Confidently With One Hand On Her D***k!

  • nanao nakano censoredmature womansingle workCEMDserebu no tomoCEMD-072CEMD072cemd00072
    • 2021-11-11
    114 min

    [GS-410]Miniskirt Reception Girl Of My Dreams Lovingly Takes My Soaking Dick In Her Mouth. Such A Beauty That My Heart Pounds Every Time I See Her. Such A Precious Flower Who Would Never Normally Turn Her Eye To A Useless Employee Like Me. One Day Wh

  • censoredblowjobGSsosoru garconreddo bo ruGS-410GS4101gs00410



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download