an 01




FC2MEYDKSBJMIDVATIDADNNGODNACRSSISDASDFSDSSVEMAWAAAMIAACESDDASDNNPJAMBICHRVNATRPRED

2020-11-06
167 min

[JUL-362](Caution Before Viewing) A Story Of Shame, That No Man Must Ever See, Unless He's A Maso Man Ever Since I Was A Young Boy, I Was Always Infatuated With My Mom's Big Sister, Auntie Tsubaki, And I Was All Set To Spend A Few Days With H

  • kato camellia kaoru natsuki censoredmature womanslutJULmadonnanao masakiJUL-362JUL362jul00362
    • 2020-11-12
    26 min

    H4610 ki201112 Chiaki Mamiya 20years old

  • amateur uncensoredh4610
    • 2020-11-14
    20 min

    FC2PPV 1569761 First shot 19 years old JD little virgin daughter Haru virgin bitch tension virgin loss

  • amateur uncensoredfc2
    • 2020-11-20
    55 min

    [oretd-800]KANNA

  • amateur censoredcreampieuniformoretdoretd-800oretd800oretd-800
    • 2020-11-20
    115 min

    [PARATHD-3046]Yankee Girl Gets A Sexual Massage And Is Made To Cum Many Times: Deluxe Edition (2)

  • censoredamateurPARATHDparadise tvPARATHD-3046PARATHD3046parathd03046
    • 2020-11-27
    476 min

    [HRV-050]Super Sexy!! Slick And Slippery Lotion-Lathered & Oiled-Up Sex 30 Ladies Best Hits Collection 8 Hours

  • censoredHRVprestigeharvestHRV-050HRV050118hrv00050
    • 2020-12-01
    77 min

    [MBRAZ-028]川口彩夏 恋してシースルー

  • kawaguchi ayaka censoredMBRAZspice visualblue ribonMBRAZ-028MBRAZ028406mbraz00028
    • 2020-12-02
    67 min

    [SHIBP-064]狙えば写るんでっす！新人グラドル5人収録！！/新人グラドル5人

  • censoredanalSHIBPshibuya promotionSHIBP-064SHIBP064h-1235shibp00064
    • 2020-12-07
    94 min

    300MIUM-655 Cheating addictive hypersexual wife! !! !! → [Abnormal sexual desire floats so much that if there is a type, it will be reversed! !! !! ] × [Anyway, “Beauty” & National Treasure-class beauty big breasts & bicubic convuls

  • amateur censoredcreampiesquirtingmiummium-655mium655300mium-655
    • 2020-12-08
    42 min

    362SCOH-017 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [Hino ● I]

  • amateur censoredcreampiesquirtingscohscoh-017scoh017362scoh-017
    • 2020-12-27
    160 min

    [MMKZ-089]A Big Ass And A Cute Face!! Ichika Matsumoto

  • ichika matsumoto censoredsingle workMMKZmarrionkojiro miyamotoirisMMKZ-089MMKZ089mmkz00089
    • 2020-12-29
    135 min

    [SDMM-081]One-Way Mirror Cab - S********ls x Cocks Jerking It - Partner Masturbation Appreciation - Will These Young Teens Give In To Their Curiosity And Offer To Help These Guys Blow Their Loads？ Will They Go All The Way？ All 4 Girls Finished With F

  • censoreduniformschoolgirlSDMMsod createakira saijomagic mirrorSDMM-081SDMM0811sdmm00081
    • 2021-01-12
    59 min

    HEYZO 2434 Exploring Every Corner Of A Fair Skin Girl! – Rin Aizawa

  • rin aizawa uncensoredcreampieheyzo
    • 2021-02-07
    47 min

    FC2PPV 1676125 [First shot] Polite and God-friendly ❤️❤️ I have made a lot of vaginal cum shot in uniform H with JD with fair skin! !!

  • amateur uncensoredfc2
    • 2021-02-07
    49 min

    FC2PPV 1676368 Until 2/10 [Uncensored] Bakery signboard girl JD ② Enjoy big butt and continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-02-10
    31 min

    FC2PPV 1680076 [With bonus video] Youkai fuck “Miss luxury soap” or “Black pussy returns” [No]

  • amateur uncensoredfc2
    • 2021-02-11
    65 min

    FC2PPV 1680935 [No] ♀ 297 Female college student Miyabi-chan, 18 years old, 1st time Dirty back dirt offer to conceive from girls! Dangerous day Ma ◯ Ko is seeded and vaginal cum shot makes her a mom! (LOL)

  • amateur uncensoredfc2
    • 2021-02-27
    129 min

    [MMND-195]Lactating Married Woman With Issues: "I Can't Do Porn" Yoshiko (Fake Name) - Giving Her Colossal H-Cup Milk Tank Tits A Thoroughly Filthy Fondling

  • censoredMMNDmimanyuki iwasawaMMND-195MMND195mmnd00195
    • 2021-02-27
    124 min

    [HONB-208]This Secretly Horny Big Tits Art College S*****t Was Working At A Convenience Store, And She Was Debating Whether To Appear In This Adult Video, But Then I Made Her Cry Caution Before Viewing She Was Tied Up And Cumming Like Crazy!

  • censoredbig titsamateurHONBmercurythe first shibuya special f e headquarHONB-208HONB208h-1133honb00208
    • 2021-03-03
    160 min

    [PFES-002]I Ordered An Escort Who Doesn't Allow Penetrative Sex, And My Quiet, Plane Jane Coworker Appeared At The Door! Starting Today This Women Is My Big Titty Raw Sex Toy Hikari Sena

  • hikari sena censoredcreampiebig titsPFESfitchsummer panties festivalPFES-002PFES002pfes00002
    • 2021-03-08
    52 min

    302GERK-353 Miu

  • amateur censoredcreampiebig titsgerkgerk-353gerk353302gerk-353
    • 2021-03-13
    151 min

    [MIDE-898]Tricked Into Servicing Her Awful Boss On A Weekend Hot Spring Trip, Cumming So Hard She Could Die... Sakura Miura

  • minamata sakura censoredbig titssingle workMIDEmoodyzbacon tanakamoodyz divaMIDE-898MIDE898mide00898
    • 2021-03-16
    70 min

    FC2PPV 1729387 ★ First shot amateur ☆ Doggy Menhera ♥ Riska’s F cup big breasts erotic body Mayuko-chan 24 years old ☆ H love electric maiki ♥ Gachiyaba rich blowjob ♥ De M temperament sexual desire processing pussy ♥ [Personal shooting] * With

  • amateur uncensoredfc2
    • 2021-03-21
    31 min

    494SIKA-065 Vibe Fixed Irama + Demon Thrust Piston to Enko J ○

  • amateur censoredsquirtinguniformsikasika-065sika065494sika-065
    • 2021-04-09
    133 min

    [MDS-890]"Teacher... Have You Every Had Sex With A Younger Girl？ It Feels Very Good, You Know...？" I Was Planning To Get Married To My Girlfriend Of 7 Years Next Summer, But After Continuous Temptation By My S*****t, She Turned My Life Upside

  • ichika matsumoto censoredcreampiebeautiful girlMDSuchu kikakugenius hizaMDS-890MDS890mds00890
    • 2021-04-17
    117 min

    [NNPJ-445]The Pick Up Artist Himself Was Astonished! The Hot Girl He Brought Home Happened To Be A Porn Star! Popular Porn Actress "Riho Fujimori" Shows Off Her Private Sex Life In This All-POV, All Real Orgasm Film (Leaked)

  • censoredcreampiesingle workNNPJnanpa japanNNPJ-445NNPJ445nnpj00445
    • 2021-04-17
    229 min

    [CJOD-293]"Please Introduce Me To Your MILF Friend" One Married Woman Creampie After Another! Cheating Wives Tired Of Their Husband's Cock

  • censoredcreampieslutCJODchijo heavenkanoa tojoCJOD-293CJOD293cjod00293
    • 2021-04-21
    35 min

    FC2PPV 1780423 [Uncensored] I got acquainted with her again ♥ I was a quiet child, but I was sloppy with man juice ♥ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-04-25
    120 min

    390JNT-021 [Super! Gonzo climax] I ● SNS picking up an H cup female college student gal who puts an erotic selfie on the star! !! It ’s so wet, it ’s a transcendental sensitive girl! !! Cum soon! Immediately Saddle tide! !! Immediately Iki GAL that i

  • amateur censoredbig titssquirtingjntjnt-021jnt021390jnt-021
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-30
    30 min

    HEYZO 2525 Creampie in America #Sophia3 – Sophia

  • sophia uncensoredheyzo
    • 2021-05-06
    60 min

    FCP-014 [Delivery only] You can do it even if it’s small! !! Super feeling good! Fucking! 1

  • amateur censoredamateurbeautiful girlfcpfcp-014fcp014fcp-014
    • 2021-05-07
    85 min

    380SQB-100 Kurumi

  • amateur censoredamateurbeautiful girlsqbsqb-100sqb100380sqb-100
    • 2021-05-07
    120 min

    [MEYD-673]Cougar Shows Off Her All-Encompassing Sexual Technique! Married G-Cup Escort Who Looks Amazing For A Woman With C***dren Makes Her Porn Debut

  • censoredbig titsMEYDtameike goromametaro mamezawaMEYD-673MEYD673meyd00673
    • 2021-05-10
    120 min

    [TENX-21041]Sex Experts With A Lifetime Of Experience Sixty Year Olds & Seventy Year Olds Version

  • censoredamateurmature womanTENXtennin xTENX-21041TENX21041h-1542tenx21041
    • 2021-05-14
    79 min

    FC2PPV 1817900 [3480 → Limited number 2480] [First shot ㊙️ Video] Only seen as an adult J’s K ❤️ Nurse dreaming 18 years old ❤️ Enjoy the immature body of one experienced person ❤️ Tell me a safe day and insert raw Massive vaginal cum shot ❤️

  • amateur uncensoredfc2
    • 2021-05-20
    300 min

    [SVDVD-858]H*********n: Male And Female S*****ts Alike Get Naked At This Nursing College To Learn Practical SK**ls 2021

  • hinako mori rumi tadami censoredcreampiesquirtingSVDVDsadistic villageista girl and her shameSVDVD-858SVDVD8581svdvd00858
    • 2021-06-10
    164 min

    [RCTD-406]Wet & Messy (WAM) Gold, Silver And Copper Powder Sports Test

  • kozomi hoshinaka misaki azusa censoredRCTDrocketscarecrowRCTD-406RCTD4061rctd00406
    • 2021-06-16
    203 min

    [HUNTB-034]"We Had Such Amazing Sex Yesterday... How Do You Not Remember Anything？ Cum Inside Me Like You Just Did!" Girl I Don't Think I've Ever Seen Before Pleads For My Dick!

  • censoredcreampieblowjobHUNTBhuntercognac kaminohhh groupHUNTB-034HUNTB034huntb00034
    • 2021-07-10
    63 min

    FC2PPV 1914070 [Personal shooting / leakage] [Secret personal photo session] with active students and underground idols Forbidden Gonzo video with her [Chibi Manko]

  • amateur uncensoredfc2
    • 2021-07-15
    120 min

    [CMC-258]A Widow with Colossal Tits and Fleshy Buttocks: A Record Book of Incidents Involving Brainwashing Stings. Riko Tokushima.

  • riko tokushima censoredsingle workCMCcinemagicshinichi kawamuracollectCMC-258CMC258cmc00258
    • 2021-07-31
    107 min

    [VEC-488]A Secret Only Between My Friend"s Mother And Me. That I Fucked And Had Creampie Sex With Her... Reina Hirokawa

  • reina hirokawa censoredcreampiemature womanVECvenuskitano majimemegami venusVEC-488VEC488vec00488
    • 2021-08-12
    124 min

    [FSDSS-279]High School Teacher, Forbidden French Kiss Fucking With High S*********ls After Class, Meisa Kawakita

  • kawakita meisa censoreduniformschoolgirlFSDSSfalenotakasato yofaleno starFSDSS-279FSDSS2791fsdss00279
    • 2021-09-04
    133 min

    [SQTE-382]Excessively Sexy Girls With Excessively Sexy Tits Private Sex At A Hotel With An S-Cute Beautiful Girl Mao Hamasaki / Kanon Amane / Konoha Narumi

  • hamazaki mao natural kanon censoredcreampiebig titsSQTEs cutes cute s cuteSQTE-382SQTE382sqte00382
    • 2021-10-01
    107 min

    [SHKD-965]That Night Where I Just Had To Creampie That Girl - Ichika Matsumoto

  • ichika matsumoto censoredsingle workSHKDattackersakawa yuushi yoru akuSHKD-965SHKD965shkd00965
    • 2021-10-07
    120 min

    [GS-407]The Best Option For Extreme Service! Micro Bikini Selfie Photo Event. Big Tits Model Shows Off In Her Micro Bikini With Hot Selfies For This Photo Event!

  • censoredblowjobGSsosoru garcontanburaGS-407GS407h-101gs00407
    • 2021-10-13
    48 min

    541AKYB-020 Asami (26) Ero X Sake Is Already Hard ^^ (Mai Arimura)

  • amateur censoredcreampiebig titsakybakyb-020akyb020541akyb-020
    • 2021-10-22
    125 min

    [BANK-058]Busty Wife Hot Spring Date--Electrifying & Super-Sexy Model Babe With Perfect, Creamy Skin: Meet 28-Year-Old Shiori

  • censoredcreampiebig titsBANKma ko ginkouyuuseiBANK-058BANK058h-1495bank00058



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download