amateur slut high vision javcensored creampie




FC2IPXHUNTBMIAAJULWAAAMVSDNGODHDKAAVSAMARAAWDMIDESANSSNISQTESTARSVENXHMNKSBJRBD

2022-02-23
88 min

[IENF-189]Picking Up Girls Featuring Amateur S********ls. Girls That Are Super Curious About Sex Enjoy Nipple Play For The First Time! "Do Male Nipples Feel It Too？" Masochistic Guy Gets Hard In Agony Over This Sadistic Teasing! Getting His N

  • natural mizuki lara kudo censoredcreampieschoolgirlIENFienergyienfIENF-189IENF1891ienf00189
    • 2022-02-19
    138 min

    [HALT-003]Seducing Two Job Seeking Sluts With Colossal Tits Lick Their Rock-Hard, Erect Nipples!! Round-Assed Hot MILFs Get Rocked For Real Hear Them Beg To Get Creampied

  • censoredcreampiebig titsHALThalentino daydream tribehalentinocomplete amateur match making partyHALT-003HALT003halt00003
    • 2022-02-03
    212 min

    [STSK-014]"I"ll Study Super Hard So Please, Please Teach Me How To Have Sex... That"s What You Like, Right Teacher？" Studious S********l Seduces Her Private Tutor... He Knows It"s Wrong, But He Just Can"t Resist Her Lustful Te

  • censoredcreampieschoolgirlSTSKamateur 39STSK-014STSK014h-1605stsk00014
    • 2021-12-09
    89 min

    [IENF-182]Amateur Pick Up Tales Naive Girl Who"s Used To Being Submissive And Who"s Never Taken The Lead With A Man Before Tries Dominating A Masochistic Guy For The First Time Watch Her Blossom Into A Talented Dominatrix! She Plays With His

  • akari shinmura mai takeda censoredcreampiebig titsIENFie nergytaiga kosakaiieneIENF-182IENF1821ienf00182
    • 2021-10-15
    148 min

    [BLK-531]Taking A Slutty Gal Till Morning! Ending Up At A Love Hotel After A Late Night Out In Kinshi-cho. She Works That Dick Over And Over All Night Long In The Hotel Room!

  • censoredcreampiebig titsBLKkira kirakira hosi kira black galBLK-531BLK531blk00531
    • 2021-10-07
    128 min

    [IENF-170]Amateur Pick Up Naive College Girl Has Her First Experience At A Brothel For Ladies 3

  • yuzu shirakawa hope light censoredcreampieslutIENFie nergytaiga kosakaiienfIENF-170IENF1701ienf00170
    • 2021-08-24
    150 min

    [KUSE-026]Amateur Demands Her Favorite Dicks For A Blowjob Home Visit! Unexpected Creampie For First-time Sex？! Plenty Of Cum In This All Out Sex Fest On Camera. 7x Dicks, 12x Cum Shots, 11x Cum Swallowing! Minami Iroha

  • minami iroha censoredcreampieamateurKUSEsod createichinose kurumijoyuu no kuse ga sugoiKUSE-026KUSE0261kuse00026
    • 2021-07-02
    170 min

    [DVDMS-683]Ordinary Couple Hidden Camera Footage AV X Magic Mirror Bus Collaboration Project "While In Japan These Cabin Attendants Can't Get Over Wanting To Try Japanese Cock" Is The Rumor True!？ A Chinese Cabin Attendant With Beautiful

  • censoredcreampieamateurDVDMSdeep sking of genkingDVDMS-683DVDMS683dvdms00683
    • 2021-06-04
    171 min

    [DVDMS-671]A Normal Boys And Girls Focus Group Adult Video x The Magic Mirror Number Bus Collaboration Variety Special Is It True That After A Flight, Cabin Attendants Want Cocks So Badly That They Can't Control Themselves!？ This Cabin Attendant

  • censoredcreampieamateurDVDMSdeep sking of genkingDVDMS-671DVDMS671dvdms00671
    • 2021-04-14
    180 min

    [DVDMS-656]You Can't Escape This Cute Slut's Nipple Teasing - 10 Days Of Creampie Sex - Horny Smiling College Girl Won't Stop Until You're Satisfied (You Weren't Expecting It)

  • censoredcreampieamateurDVDMSdeep sking of genkingDVDMS-656DVDMS656dvdms00656
    • 2021-04-09
    144 min

    [DASD-847]The Face Of A Model, But The Kinks Of A Total Slut - A Single Mother's Mature Nipples Teased Until She Succumbs To Her Lust - Fun With A Nympho Divorcee. (*Of Course, She Gets Fucked Raw)

  • censoredcreampieamateurDASDdasDASD-847DASD847dasd00847
    • 2021-03-13
    194 min

    [HJMO-456]This Husband And Wife Are Taking The Challenge! If The Husband Succumbs To Honoka Tsujii's Amazing Techniques And Cums Twice, His Wife Will Be Subjected To Raw Cuckold Creampie Sex!

  • tsujii honoka censoredcreampiebig titsHJMOhajime kikakuHJMO-456HJMO456hjmo00456
    • 2021-02-19
    223 min

    [SIM-109]My Super Young Stepmom Is A Total Slut - She's Down To Fuck Her Stepson Any Time He Wants

  • censoredcreampieSIMprestigeamateur pussiesSIM-109SIM109118sim00109
    • 2021-02-19
    125 min

    [KTKC-106]These Are The Famous Streetwalking Reverse Pick Up Colossal Tits Girls In A Town In The Northern Kanto Region, Who Have Recorded 3,000 Mounting, Grinding, Raw Cowgirl Fucks, And We've Captured 12 Fucks In One Day In The Creampie Documen

  • censoredcreampiebig titsKTKCkitixx mousouzokubig titsKTKC-106KTKC106ktkc00106
    • 2021-02-18
    165 min

    [DVDMS-634]She's Got A Cute Face And A Bushy Pussy! This Perverted College Girl Loves To Get Cunnilingus When She Gets Her Deep Forest Of Pussy Hairs Licked, It Awakens Her Perversions ... And Then She'll Beg For Creampie Sex, Over And Over A

  • censoredcreampieamateurDVDMSdeep sking of genkingDVDMS-634DVDMS634dvdms00634
    • 2021-01-22
    53 min

    [WKD-038]Amateur File

  • censoredcreampieslutWKDwaap entertainmentk westwWKD-038WKD0382wkd00038
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-08
    139 min

    [IENF-118]Sensitive Nipples Make Her Cum Quickly! Slut With Beautiful Tits Challenged To Thigh Sex! Then Pounded Until She Cums Over And Over Again, Pumped Full Of Creampies!

  • censoredcreampieamateurIENFienergytiger kosakaiienfIENF-118IENF1181ienf00118
    • 2020-12-31
    240 min

    [DVDMS-616]Ordinary Guys And Girls Caught On Camera - Amateur College Couples Separated By A One-Way Mirror Try To Resist Porn Stars' Incredible Sex Techniques! Amateur College Guys (Boyfriends) VS The Actress The Men Of The World Have Fallen In

  • yui hatano censoredcreampieamateurDVDMSdeep sfunky hasegawaDVDMS-616DVDMS616dvdms00616
    • 2020-12-25
    236 min

    [SIM-103]The Best Friend-With-Benefit Is A Married Woman Whose Husband Is Away - You Don't Even Have To Pay For A Hotel! 13 Shots Of Lush Quickie Cumshots Right At Home

  • censoredcreampiebig titsSIMprestigeamateur pussiesSIM-103SIM103118sim00103
    • 2020-12-12
    143 min

    [YAKO-021]40-Year-Old Slut Has Daily Creampie Sex With Randoms From A Hookup App, Got So Horny She Starred In Porn "My Husband Has No Idea Our K*d Might Not Be His"

  • censoredanalamateurYAKOmercuryshinjuku undergroundYAKO-021YAKO021h-1133yako00021
    • 2020-10-27
    114 min

    [YAKO-018]Barely Avoiding A Ban - Extreme Slut Vlogger Pushes The Limits Of Her Platform 'Bouncing Big Tits' Leaked Unedited Footage From Before Her Account Got Shut Down

  • censoredcreampiebig titsYAKOmercuryshinjuku undergroundYAKO-018YAKO018h-1133yako00018
    • 2020-10-22
    212 min

    [MADM-132]Forty-something Madam, Follow-up Filming SEX

  • akiyama bookmark sakura riona censoredcreampieamateurMADMcrystal eizotakeshi matsudairamadam maniacMADM-132MADM13249madm00132
    • 2020-10-02
    259 min

    [VPC-002]Leaked Private Footage Of Super Erotic Amateur. A Super Cute Slut's Private Erotic Video 02

  • censoredcreampiebig titsVPCprestigevideo podcastVPC-002VPC002118vpc00002
    • 2020-09-17
    240 min

    [DVDMS-580]A Normal Boys And Girls Focus Group Adult Video A Loving College S*****t Couple Enters The Special Magic Mirror Room And Go Into Separate Rooms To See If They Can Resist The Amazing Techniques Of Our Adult Video Actress And Actor!! A Super

  • hasumi claire censoredcreampieamateurDVDMSdeep sfunky hasegawaDVDMS-580DVDMS580dvdms00580
    • 2020-09-08
    120 min

    [SDMM-070]A Neat And Clean Girl Who Cannot Be Seduced Vs A Brainwashed Slut Bitch In A Battle To The Death! This Girl Has A Strong Defense, But I Confused Her With My Hard Cock And Now I'm Hitting Her With Unlimited Pussy Pounding Thrusts In This

  • censoredcreampieamateurSDMMsod createakira saijomagic mirrorSDMM-070SDMM0701sdmm00070
    • 2020-08-28
    62 min

    [KBTV-011]A Slut's Friends Are Also Sluts: A Theroy

  • censoredcreampiebig titsKBTVgoing too far tvKBTV-011KBTV011h-1514kbtv00011
    • 2020-08-21
    254 min

    [VPC-001]Leaked Private Footage Of Super Erotic Amateur. A Super Cute Slut's Private Erotic Video 01

  • censoredcreampiebig titsVPCprestigevideo podcastVPC-001VPC001118vpc00001
    • 2020-08-07
    160 min

    [DPSDL-002]A Massive And Solid Big Ass! I Spent All Day Locked In A Love Hotel Having Cum Crazy Creampie Sex With A Horny And Crude Wife!!

  • censoredcreampieamateurDPSDLdeep sfunky hasegawaDPSDL-002DPSDL002dpsdl00002
    • 2020-08-07
    200 min

    [DPSDL-003]While She Lay There, Exposing Her Ass, I Slowly Inserted My Cock Into Her Pussy, And Then She Couldn't Stop Cumming... An Office Lady With A Beautiful Ass And Light Skin Is Showing Off Her Relentless Cowgirl Super Slow Thrusting Techni

  • riho fujimori aoi mizutani censoredcreampieamateurDPSDLdeep sking of genkingDPSDL-003DPSDL003dpsdl00003
    • 2020-07-24
    228 min

    [SIM-083]I Got Horny Watching This Hard-Working Nurse And When I Could No Longer Resist, I Had To Have An Insta Fuck!？ Faced With Sudden Creampie Sex, This Nurse Became Instantly Horny And Started To Shake Her Ass And Then She Came, Over And Over Aga

  • censoredcreampieslutSIMprestigeamateur pussiesSIM-083SIM083118sim00083
    • 2020-07-12
    130 min

    [YAKO-012]A Legendary Amateur Slut From Tochigi! - "I'm A Big Titty Bitch Gal And I've Fucked Over 1000 Guys!"

  • censoredcreampiebig titsYAKOmercuryshinjuku undergroundYAKO-012YAKO012h-1133yako00012
    • 2020-07-10
    125 min

    [GYAN-008]This Excessively Cool And Bewitching Half-Japanese Girl With A Premium-Quality Beautiful Face Is Losing Her Mind And Panting And Moaning Like Those Horny Exhibitionist Women And Now Her Downfall To Slutty Bitch Degradation Is Complete LOL H

  • censoredcreampieamateurGYANprestigehimulockgyan prestigeGYAN-008GYAN008118gyan00008
    • 2020-07-10
    121 min

    [SABA-631]Tokyo Office Lady Calendar 03 - A Slut From Toranomon, Working As A Secretary At A Consulting Company - Mio-san, 25yo

  • censoredcreampieamateurSABAskyu shirotofc3 amateur fuck groupSABA-631SABA631h-244saba00631
    • 2020-07-10
    214 min

    [SABA-633]All New Creampie Raw Footage Of A Tokyo Slut Gal S********l With Charisma To Spare Vol 002

  • censoredcreampieuniformSABAskyu shirototodoSABA-633SABA633h-244saba00633
    • 2020-06-12
    120 min

    [SABA-625]Tokyo Office Lady Calendar 02 An Orgasmic Slut In Kagurazaka A Graduate Of W University She Works As A Secretary At A Popular Freelance Temp Agency Nozomi-san 24 Years Old

  • censoredcreampieamateurSABAskyu shirotofc3 amateur fuck groupSABA-625SABA625h-244saba00625
    • 2020-06-06
    197 min

    [PRED-239]3rd Anniversary, Amateur Appreciation, Aika Yamagishi

  • aika yamagishi censoredcreampieslutPREDpremiumzampaelegancePRED-239PRED239pred00239
    • 2020-05-16
    163 min

    [PPPD-848]An Ultra Flesh Fantasy Amateur Big Tits Wife Was Enjoying Raw Fucking Creampies Behind Her Husband's Back All Day Long Until Her Adultery Partner's Cock Couldn't Get Hard Anymore 15 Cum Shots!

  • censoredcreampiebig titsPPPDoppaiPPPD-848PPPD848pppd00848
    • 2020-05-15
    229 min

    [BAZX-232]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 001

  • censoredcreampieuniformBAZXbazookatodoBAZX-232BAZX232h-1496bazx00232
    • 2020-04-28
    117 min

    [EQ-516]Old Ladies! Please Pump My Cock! Mature Woman Ladies Who Lust For Masturbating Men 8

  • censoredcreampiebig titsEQbullittshinobu kamezufetish specialtyEQ-516EQ516h-100eq00516
    • 2020-04-26
    160 min

    [LULU-018]"Ahhhh, What A Waste!" After A Pussy-Pounding Piston Cowgirl, He Flooded Her Pussy With His Young Semen, So She Gave Him A Nice Blowjob, And Then He Was Ready To Pump Her Cunt Again (Pussy To Mouth Sex)

  • censoredcreampieamateurLULUlunaticsvagmanLULU-018LULU018lulu00018
    • 2020-04-10
    242 min

    [MGT-108]Picking Up Amateurs On Street Corners! Vol. 83 Introduce Me To A Friend (Slut) Who's Hotter Than You! 11

  • censoredcreampiebig titsMGTprestigemegatraMGT-108MGT108118mgt00108
    • 2020-03-29
    150 min

    [LULU-013]Every Day, After Her Husband Leaves For Work She Brings In A Young Orgasmic Boy To Her Home For Creampie Sex, And Then Some Long Snake-Tongued Follow-Up Blowjob Action And Lets Him Ejaculate His Big Cock Over And Over Again Because She'

  • censoredcreampieamateurLULUlunaticsvragmanLULU-013LULU013lulu00013
    • 2020-03-29
    104 min

    [KTKC-080]Captured Abroad! - A Beautiful Spanish Slut With Hormones Firing On All Cylinders

  • censoredcreampiebig titsKTKCkitixx mousouzokubig titsKTKC-080KTKC080ktkc00080
    • 2020-02-28
    226 min

    [SIM-063]A Dream Come True？! "You Can Cum Inside Me As Long As You Don't Tell!" Hot Nurse Performs Sexy Service In The Middle Of The Night! She'll Suck Up All Of Her Patients Built Up Cum Creampie Caretaker!

  • censoredcreampieslutSIMprestigeno directoramateur pussiesSIM-063SIM063118sim00063
    • 2020-02-01
    160 min

    [DVDMS-502]Amateur Documentary Porn: Some Tipsy Higher Ups From Work With Colossal Tits Came Over To Have Fun. I Hit On Them, Then They Got Creampied Until Morning

  • censoredcreampiebig titsDVDMSdeep sswing nagaseDVDMS-502DVDMS502dvdms00502
    • 2019-12-19
    119 min

    [CJOD-219]A Handjob Angel Has Cum Down Upon Us She's So Cute And She Looks Just Like **** That It's Annoying! And She Has Big Tits Too We Hooked This Fabulous Discovery Of An Amateur Girl And Now She's Making Her Adult Video Debut!

  • censoredcreampiebig titsCJODchijo heavenhirokoji osakiCJOD-219CJOD219cjod00219
    • 2019-12-15
    135 min

    [EMRD-154]A Chubby Gal With Big Tits Does A Porno! - A Famous Slut In Her Hometown, Her Hobby Is Giving Blowjobs, And Her Sexual Desire Knows No Bounds - She's Cute And Sexy At The Same Time - Mai

  • censoredcreampiebig titsEMRDemperor mousouzokuEMRD-154EMRD154emrd00154



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download