amateur pussies




FC2LULUSTARSATIDCAWDCESDMILKSPRDSSNIPPPDMIDVSQTEAPODAUKSMEYDGMEMNATRAVSAHDKARBDAUKG

2019-10-25
250 min

[SIM-047]A JK Braless Stroll!! When This Remote Vibrator Gets Turned Onn, Her Nipples Are Rock Hard And Erect! Will She Seriously And Bashfully Cum In Public!？ 3

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-047SIM047118sim00047
    • 2019-10-18
    234 min

    [SIM-046]"We Don't Need A Condom..." A Hottie Nurse Makes Lots Of Close-Up Sweaty Creampies With A Big Cock Guy, Inside The Futon So The Other Patients Don't Find Out

  • censoredcreampieamateurSIMprestigeamateur pussiesSIM-046SIM046118sim00046
    • 2019-10-16
    237 min

    [MADM-121]These Horny Housewives Are Linking Up Their Pussies In A Row! Introduce Us To A Friend Who Is Sexier Than You!

  • censoredcreampieamateurMADMcrystal eizomadam maniacMADM-121MADM12149madm00121
    • 2019-09-27
    244 min

    [SIM-045]This Real-Life Nurse Is Kindly And Gently Nursing Her Cherry Boy Patient (Who Can't Move His Arms Or Legs) With Cherry Popping Sex! Dedicated And Kind Cowgirl Cherry Boy Popping Sex! 2

  • censoredcreampieamateurSIMprestigeamateur pussiesSIM-045SIM045118sim00045
    • 2019-08-23
    245 min

    [SIM-043]Simple And Cute Female Students Playing With Their Nipples Let You Creampie Them Over And Over Again!？

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-043SIM043118sim00043
    • 2019-08-16
    237 min

    [SIM-042]A Soft And Soothing Sch**lgirl Titty Pub Experience!？ You'll Be Surrounded By Big, Sensual Titties And You Can Fondle And Suck Them Until She Starts Feeling So Good She'll Start Servicing You With Some Raw Sex Service Hustle Time!!

  • censoredcreampiebig titsSIMprestigeamateur pussiesSIM-042SIM042118sim00042
    • 2019-08-09
    545 min

    [SKMJ-057]Amateur College Girls Only! They Rub Their Pussies On Hard Cocks Through Their Panties Until Their Faces Turn Red! Their Crotches Are Embarrassingly Wet! They Take Off Their Panties And Rub Some More Until The Guys' Cocks Finally Slide

  • censoredcreampieamateurSKMJred face girlone topSKMJ-057SKMJ057h-1324skmj00057
    • 2019-06-28
    244 min

    [SIM-039]"Since It's Your First Time... You Can Cum Inside Me!" This Kind And Gentle Big Tits Female Teacher Is Giving This Cherry Boy A Wonderful Cherry Popping Good Time!？ A Real-Life Teacher Is Unable To Control Her Pussy Pressure Agai

  • censoredcreampiebig titsSIMprestigeamateur pussiesSIM-039SIM039118sim00039
    • 2019-06-21
    241 min

    [SIM-038]I Was Having Amazing Sex With This Modern Sch**lgirl When She Got On The Phone And Introduced Me To Her Friend!？ My Network Of Cute And Sexy Friends Is Getting Bigger And Bigger!! Creampie Raw Footage Of Sex With Everybody

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-038SIM038118sim00038
    • 2019-04-26
    220 min

    [SIM-034]A Real-Life Female Teacher Gets Her Brains Blown Out With Aphrodisiacs For The First Time And Now She's Ready For Pissing And Wetting Yourself In Creampie Raw Footage!？

  • censoredcreampieamateurSIMprestigeamateur pussiesSIM-034SIM034118sim00034
    • 2019-04-19
    233 min

    [SIM-033]Innocent New Employee In Black Pantyhose Without Panties Having Intercrural Sex!？ I Rub My Big Cock Against Her Pussy Directly Over Pantyhose! Then I Rip The Excited Office Lady's Pantyhose And Have Bareback, Creampie Sex With Her!!

  • censoredcreampieuniformSIMprestigeamateur pussiesSIM-033SIM033118sim00033
    • 2019-03-29
    243 min

    [SIM-031]I Got Super Excited For A Sch**lgirl In Knee-High Socks And The Total Domain Of Her Hot Thighs...

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-031SIM031118sim00031
    • 2019-03-29
    228 min

    [SIM-030]Hospital Visit Cuckold Sex!! Her Husband Is In The Next Bed Over, But This Married Woman Is Lonely And No Longer Able To Control Her Lust...!？

  • censoredcreampieamateurSIMprestigeamateur pussiesSIM-030SIM030118sim00030
    • 2019-03-22
    241 min

    [SIM-029]A JK Braless Stroll!! When This Remote Vibrator Gets Turned Onn, Her Nipples Are Rock Hard And Erect! Will She Seriously And Bashfully Cum In Public!？ 2

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-029SIM029118sim00029
    • 2019-03-15
    240 min

    [MBM-016]Super Voluptuous. The Big Asses Of Mature Women Feel Better Than Their Pussies!! 12 Women, 4 Hours

  • censoredbig titsamateurMBMmbmgaro sasazukaMBM-016MBM016h-460mbm00016
    • 2019-03-08
    242 min

    [SIM-028]An Amateur Married Woman Kisses Passionately Outdoors For The First Time!？ The Thrill Of Kissing On The Street And The Excitement Of A Passionate Kiss Turns The Married Woman On...

  • censoredcreampieamateurSIMprestigeamateur pussiesSIM-028SIM028118sim00028
    • 2019-02-15
    481 min

    [PYM-295]The Amateur Nude Photo Session Bashful And Exciting Masturbation 50 Girls/8 Hours Pussies And Masturbation, They're Baring It All!

  • censoredamateurPYMprimoPYM-295PYM295h-283pym00295
    • 2019-02-15
    233 min

    [SIM-025]This Orgasmic Guy Pretended To Be A Cherry Boy And Furiously Pumped This Snowboarding College Girl He Met On The Slopes!! No Matter How Many Times She Came, He Kept Ignoring Her Pleas To Stop And Kept On Pumping Away! Her Orgasmic Pussy Tigh

  • censoredcreampieamateurSIMprestigeamateur pussiesSIM-025SIM025118sim00025
    • 2019-02-08
    241 min

    [SIM-023]Caught On Cuckold Dash Cam Video Recorders Vol.1 A Shameful Video Record Of A Married Woman And Her Male Colleague Caught Inside A Car

  • censoredcreampieamateurSIMprestigeamateur pussiesSIM-023SIM023118sim00023
    • 2019-02-08
    242 min

    [SIM-024]The New Employees Are Getting A Titty Examination!! A Pussy And Anal Sexual Harassment Checkup!

  • censoredcreampieamateurSIMprestigeamateur pussiesSIM-024SIM024118sim00024
    • 2019-02-01
    245 min

    [SIM-022]A Job-Hunting College Girl Who Dreams Of Being An Announcer Gets Pleasured By A Fixed Vibrator In Her Pantyhose During A Job Interview!! Red-Faced, Dirty Reporting With The Unrelenting Vibrator Inside Her!

  • censoredcreampieamateurSIMprestigeamateur pussiesSIM-022SIM022118sim00022
    • 2019-01-25
    232 min

    [SIM-020]Sex Education That's A Little Extreme!？ A Female Student Experiences Upside-Down Deep Throat!! The Feeling Of Her Throat Being Stimulated And Getting Her Face Dirty With Drool Turns Her On!？ She Gets A Big Cock In Her Pussy And Throat!!

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-020SIM020118sim00020
    • 2019-01-25
    240 min

    [SIM-021]A Neat And Clean Married Lady With Big Tits Experiences The Unisex Lotion Bath For The First Time! The Pleasure Of Intimate Lotion Play Drives The Married Woman Crazy!？ Slippery Creampie Sex! 21 Shots!

  • censoredcreampiebig titsSIMprestigeamateur pussiesSIM-021SIM021118sim00021
    • 2019-01-18
    230 min

    [SIM-019]A Man's Fantasy Comes True!？ A Nurse Comes To Visit You In Bed At Night While On Duty!! It's Her First Time And She's So Excited, She Can't Stop Grinding In The Cowgirl Position- She Orgasms Repeatedly And Gets Creampied! 21

  • censoredcreampieamateurSIMprestigeamateur pussiesSIM-019SIM019118sim00019
    • 2018-12-21
    236 min

    [SIM-014]Picking Up A Dead Drunk Beauty In A Swimsuit! Tequila Swallowing, Drunk Sex!! The More She Drinks, The More Sensitive Her Pussy Gets. We Fuck Her Relentlessly Even After She Orgasms Over And Over Again. 20 Creampies In Total!!

  • censoredcreampieamateurSIMprestigeamateur pussiesSIM-014SIM014118sim00014
    • 2018-12-21
    230 min

    [SIM-013]A Beautiful New Teacher Tries To Help Men With Premature Ejaculation Problems! She Tenderly Encourages The Sensitive Cocks That Almost Explode Just From Being Touched And Has Pleasurable Creampie Sex!! 31 Ejaculations

  • censoredcreampieamateurSIMprestigeamateur pussiesSIM-013SIM013118sim00013
    • 2018-12-07
    222 min

    [SIM-010]Picking Up College Girls For Real! And Suddenly Fucking Them! Relentless Sex!! College Girls Are Bewildered When They're Fucked At "Nice To Meet You" But Their Pussies Get More Sensitive!! They're Relentlessly Fucked Even Aft

  • censoredcreampieamateurSIMprestigeamateur pussiesSIM-010SIM010118sim00010
    • 2018-11-23
    231 min

    [SIM-008]Sexually Frustrated Apartment Mom With Big Tits Gets Her Love Juices Turned Into Meringue With Teasing Intercrural Sex!! She Gets Her Pussy Rubbed By A Bare Dick And Has Continuous Orgasms!!

  • censoredcreampiebig titsSIMprestigeamateur pussiesSIM-008SIM008118sim00008
    • 2018-11-09
    238 min

    [SIM-006]"Am I A Maso Bitch？" This Uniform Wearing JK Is Having Sexual Problems And Has Decided To Take On Her First S&M Vibrator Experience! She's Getting Tied Up In Humiliating Fashion And Unable To Move As She Gets Her JK Pussy Fitt

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-006SIM006118sim00006
    • 2018-11-02
    240 min

    [SIM-005]This Thirty-Something Young Wife Who Is Having Sexual Problems With Her Husband Is Furiously Lavishing You With Hot Smothering Kisses And Creampie Sex!! She's Getting Her Mind Blown With Deep And Rich Furious Kisses She Could Never Get F

  • censoredcreampieamateurSIMprestigeamateur pussiesSIM-005SIM005118sim00005
    • 2018-11-02
    232 min

    [SIM-004]This Teenage Girl Who Worries About Her Love Life Is Having Her First Follow-Up Creampie JK Soapland Experience!! When She Experiences Her First Ever Lotion Lathered Soapland Plays Her Slippery Pussy Is Ready For His Raw Cock To Just Slip Ri

  • censoredcreampiebig titsSIMprestigeamateur pussiesSIM-004SIM004118sim00004
    • 2018-10-26
    244 min

    [SIM-002]A Busty Mom Has Continuous Creampie Sex Without Pulling Out For The First Time In Her Life!! Her Postpartum Pussy Is Sensitive And Tight, Once You're Inside Her, She Won't Let You Go!？ Her Pussy Grips Your Dick! Continuous Creampies

  • censoredcreampiebig titsSIMprestigeamateur pussiesSIM-002SIM002118sim00002
    • 2018-10-26
    245 min

    [SIM-003]A Busty College Girl With G-Cup Tits Experiences Intense Titty Play & Titty-Pressing Creampie Sex For The First Time In Her Life!! "Guys Who Are Turned On By Boobs Are Cute!" The Insatiable Dick That Keeps Getting Hard With Titty

  • censoredcreampieamateurSIMprestigeamateur pussiesSIM-003SIM003118sim00003
    • 2018-10-19
    230 min

    [SIM-001]Only Sisters And Brothers Who Are Close! How Would You Like To Take Your Little Brother's Virginity？ A Kindhearted Sister Lectures Her Younger Brother About Sex!？ Shyly Feeling The Manliness Of Her Little Brother's Cock, Her Pussy Ti

  • censoredcreampieamateurSIMprestigeamateur pussiesSIM-001SIM001118sim00001
    • 2018-10-16
    241 min

    [IBW-692]The Stained Panties Of Beautiful Girls With Shaved Pussies. 4 Hours

  • amateur amateur censoredbeautiful girllingerieIBWi b worksIBW-692IBW692
    • 2018-01-20
    119 min

    [BABA-125]Hey Ladies! Is That What We Think It Is!？ You Shouldn't Be Exposing Your Pussies Like That! Let Us Dig These Panties Into Your Pussies As Far As They Will Go! 2 40 Ladies

  • censoredmarried womanamateurBABAredwifeBABA-125BABA125baba00125
    • 2017-12-25
    240 min

    [SGSR-201]From Happy Drunk Girls To A Dead Drunk Girl! Creampie Sex With These Drunk Pussies 15 Girls/4 Hours PANTV 0001

  • censoredcreampieamateurSGSRbig morkalsakaegyou chuuSGSR-201SGSR20157sgsr00201
    • 2017-11-24
    119 min

    [SGA-102]The Best Creampie Sex With The Best Lover. 22 Beautiful Shaved Pussies

  • censoredcreampieamateurSGAprestigeupdatingSGA-102SGA102118sga00102
    • 2017-01-13
    239 min

    [NASS-562]20 Ladies With Pussies So Incredible They'll Melt Any Man Into Mush! "She'll Suck And Slurp You To Oblivion" "It Feels So Tight" This Slutty Mature Woman Will Suck You Down To Your Very Last Drop Of Semen!!

  • censoredamateurmature womanNASSnadeshikohisashi daikichiNASS-562NASS562h-067nass00562
    • 2016-12-18
    240 min

    [DVDMS-062]The Magic Mirror Number Bus All Teenage Barely legal Pussies! We're Asking These Hard Working Students Who Are Studying For Their College Entrance Exams To Let Off Some Horny Lust By Showing Us How They Love Masturbation "Show Us H

  • censoredamateurhandjobDVDMSdeep sluminaxthe magic mirrorDVDMS-062DVDMS062dvdms00062
    • 2016-08-26
    120 min

    [RDT-260]Her Titties And Pussies In A Skin-Tight Maxi Dress Got Me Horny...

  • censoredbig titsamateurRDTprestigeupdatingRDT-260RDT260118rdt00260
    • 2015-05-21
    242 min

    [DVDES-848]We Picked Up College Girls - In Hakone! Their Pussies Start To Glow While Closely Washing Unfamiliar Male Hot-Spring Customers - Using Their Boobs! Once These Amateur Girls Start Feeling Too Horny To Be Shy, They Dare To Have Bareback Sex,

  • censoredbig titsamateurDVDESdeep smasakiDVDES-848DVDES8481dvdes00848



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download