amateur jav mature woma high visio hours more




FC2JUFECHRVHZGDMARANATRNACRHDKAWAAASQTEPREDDASDCESDAMBINACXSTARSHODVNGODSPRDROYDVENX

2020-09-25
240 min

[GIGL-620]30-Something Working Married Woman's Secret Sexy Side Gig - We Scored Embarrassing Private Footage Of Married Sluts Catering To Guys With Underwear Fetishes And Sold It As Porn!

  • censoredcreampieamateurGIGLgigolo gigologigoloGIGL-620GIGL620h-860gigl00620
    • 2020-10-04
    106 min

    [VEC-444]My Mom's Friend Mako Oda

  • oda mako censoredcreampiebig titsVECvenuskaniemegami venusVEC-444VEC444vec00444
    • 2020-10-04
    245 min

    [SORA-273]The New Big Tits Female Teacher Got G*******g Fucked During An Outdoor Sketching Session And Now She's Cumming In Shame Witness These Cum Buckets Writhing And Moaning In The Pleasure Of Shame... Honoka Wakamiya

  • honoka wakamiya censoredsingle workSORAyama to sorausubashisuiSORA-273SORA273sora00273
    • 2020-10-08
    119 min

    [GS-359]"I've Been Lonely For So Long, I Just Want Some Attention" I Went To Stay At A Country Inn, And Ordered Some Service, And This Sexy, Alluring Young Lady Came Over To Serve Me, And We Hit It Off Like Gangbusters Excuse Me Miss, I K

  • censoredblowjobGSsosoru x garconspada ikebukuroGS-359GS3591gs00359
    • 2020-10-18
    111 min

    [DDOB-081]Intense Pussy Orgasms - Breeding The Chubby MILF Next Door Ayaka Makimura

  • ayaka makimura censoredbig titsmature womanDDOBdogmatenunmy auntDDOB-081DDOB081ddob00081
    • 2020-10-20
    52 min

    300NTK-452 Gekokujo Piston! !! Bullying daughter Yariman beauty gal with a different adult Ji ○ Ko and intense piss revenge! !! Boneless with continuous vaginal cum shot to Yariman Galma Co ○ who is splendidly cheating! ？？ This is a real pleasure 10

  • amateur censoredcreampieamateurntkntk-452ntk452300ntk-452
    • 2020-10-22
    80 min

    [REBD-503]Abnormal Mademoiselle Nozomi - Nozomi Arimura

  • arimura nozomi censoredsingle workREBDrebeccachikara sawamuraREBD-503REBD503h-346rebd00503
    • 2020-10-25
    100 min

    [HNM-009]As A Masochistic Woman... Meiko Overcomes Her Limits And Cries At The Pleasure She Finds On The Other Side - Meiko Nakano

  • meiko nakao noa censoredbdsmsingle workHNMavs collector susubashisuiblack mariaHNM-009HNM009hnm00009
    • 2020-10-26
    104 min

    [SHN-062]Sensitive (And Shamed) Groping Big Tits In 2020 Easygoing College Girl With (We Guess) H Cups, And A Bartender With (Perhaps) F Cups

  • censoredbig titssquirtingSHNnatural highkansukenatsu carefully selected daughterSHN-062SHN0621shn00062
    • 2020-11-17
    61 min

    Pacopacomama 111720_385 Miria Hazuki

  • miria hazuki uncensoredcreampieblowjobpacopacomama
    • 2020-12-09
    58 min

    FC2PPV 1599635 [Limited to 3 days] Dating service-loving 18-year-old and 2nd round & 2 mass squirting floods the bed

  • amateur uncensoredfc2
    • 2020-12-23
    48 min

    FC2PPV 1617526 [Personal shooting] 18-year-old neat and clean beautiful girl ④. Creampie in the vagina at the sports festival bloomers ♡ Seeding competition between boyfriend and uncle Enko ♡ “Please make me pregnant with Enko O-nchin … ♡&#

  • amateur uncensoredfc2
    • 2020-12-26
    140 min

    [JUKF-053]I've Always Loved You, Teacher. Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiebeautiful girlJUKFjumpjump avJUKF-053JUKF053h-227jukf00053
    • 2020-12-27
    74 min

    [ETQR-179](Daydream POV) Sex In Her School Uniform - Banging My S*****t Right Before Her Graduation Tsumugi Narita

  • censoredcreampiebig titsETQRerotic timeETQR-179ETQR179h-1186etqr00179
    • 2021-01-03
    47 min

    FC2PPV 1630188 Rikako, a Roppongi lounge girl who was deceived by a massage recruitment and abandoned her pride ❤️ Raw squirrel to a slender beauty who stays high ❤️ A sticky villa villa that was used in the pillow business There is a purchase privil

  • amateur uncensoredfc2
    • 2021-01-06
    51 min

    FC2PPV 1634672 Limited to 300 [Uncensored] Bakery signboard girl JD’s big butt ejaculation and continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-01-09
    155 min

    [MIFD-145]A Fresh Face A Real-Life English Female Teacher From A Famous Private School She's Bilingual And Quarter-Japanese And Beautiful Her Adult Video Debut She's About To Quit Her Job And Move Overseas In A Month, But Suddenly Her Plans C

  • aso margaret nanami censoredsingle workMIFDmoodyzmichiru arashiyamamoodyz freshMIFD-145MIFD145mifd00145
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-21
    241 min

    [HAWA-236]Slender Proper-Looking Wife Is Actually A Sexual Beast Who Loves Swallowing Cum! She D***ks Up 16 Cumshots With A Smile On Her Face

  • censoreddeepthroatHAWAcosmos eizohawai nagasecosmospictures soft on demandHAWA-236HAWA2361hawa00236
    • 2021-01-23
    120 min

    [HND-938]This College Girl Is A Genius Cowgirl Fucker Who Loves To Pound Penises With Cowgirl Sex, And She Came All The Way From Hakata For Her First Raw Creampie Fuck Saya Matsui

  • saya matsui censoredcreampiebeautiful girlHNDhon nakamametaro mamezawaHND-938HND938hnd00938
    • 2021-01-27
    42 min

    FC2PPV 1661041 [No individual shooting, God beauty, Blow & Titty fuck] It’s Gachiero with a smile on the filthy Santa of God beauty Rina-chan with a smile w Kuri-chan with full intensive masturbation w

  • amateur uncensoredfc2
    • 2021-02-01
    148 min

    [DKWT-006]Young Wife's Delicious Pantyhose: Aoi, 27 Years Old, 3rd Year Of Marriage

  • censoredsquirtingDKWToffice k sDKWT-006DKWT00636dkwt00006
    • 2021-02-12
    119 min

    [DASD-811]My Sweet Girlfriend Got Bred By A No-Good Neighborhood Thug. Natsuki Mizuno

  • mizuno nagisa censoredcreampiesingle workDASDdasrokusaburo mishimaDASD-811DASD811dasd00811
    • 2021-02-27
    51 min

    C0930 ki210228 Mariko Miyazawa 24years old

  • amateur uncensoredc0930
    • 2021-03-12
    32 min

    FC2PPV 1723919 [Personal shooting] A young wife with big breasts in Kansai escapes to her husband and is disappointed! Play with whip big tits and big ass [Creampie]

  • amateur uncensoredfc2
    • 2021-03-17
    81 min

    FC2PPV 1730738 [First time limited 1000pt off] Beautiful wife of celebrity from Hong Kong ❤️ Appearance The aircraft is "I want to H" ❤️ I do not know in overseas notation … Big breasts？ Big tits! ❤️ Enchanted by the cock after a long ti

  • amateur uncensoredfc2
    • 2021-04-03
    62 min

    10musume 040321_01 The Structure Of Woman : There is a slight fever in the vagina due to the friction of the dick Yu Nagata

  • amateur uncensored10musume
    • 2021-04-08
    62 min

    Pacopacomama 040821_457 Horny Wife Helps to Lose Younger Boy’s Virginity 3 Chisato Nishiyama

  • amateur uncensoredpacopacomama
    • 2021-04-15
    122 min

    [AKDL-101](Girls You Can Fuck At Work) I Trained My Nurse Fuck Buddy On The Job - Creampie Sex And Cum Swallowing Footage (Shizuka, Age 22) Shizuka Sugisaki

  • shizuka sugisaki censoredcreampiebeautiful girlAKDLaquinoriaquinoriaknrAKDL-101AKDL1011akdl00101
    • 2021-04-16
    54 min

    230OREC-739 Ai

  • amateur censoredcreampiebig titsorecorec-739orec739230orec-739
    • 2021-04-18
    120 min

    [BLB-007]A Big Black Dick A Japanese Mature Woman Gets Fucked Was Her Beloved Husband An Evil Man!？ This Wife Was Deceived And Downfallen Into A Shameful Four-Way G*******g Fuck Fest Of Hell Yuri Tadokoro

  • yuri tadokoro censoredmature womansingle workBLBglobal media entertainmentjiro sadogashimablack beastBLB-007BLB007blb00007
    • 2021-05-02
    240 min

    [YLWN-166]Sex Diary With My Friend's Mother 4 Hours

  • censoredmarried womanmilfYLWNyellow moonpatpong tateishiYLWN-166YLWN166ylwn00166
    • 2021-05-07
    152 min

    [DASD-858]I'm A Lowly S*****t, But I Succumbed To The Sweet Temptation Offered By Two Female Teacher Babes, And Now, After School, We're At The Love Hotel, Having Creampie Sex, Over And Over And Over Again. Waka Misono Yuria Yoshine

  • misono waka yoshine yuria censoredcreampiebig titsDASDdasrokusaburo mishimaDASD-858DASD858dasd00858
    • 2021-05-08
    152 min

    [MKMP-396]I Know It's Wrong ... But I Can't Resist. My Best Friend's Little Sister Is Luring Me With Absolutely Irresistible Panty Shot Temptation And I Have Succumbed, Over And Over Again Nako Hoshi

  • nako hoshi censoredschoolgirlbeautiful girlMKMPk m producegoemonmillionMKMP-396MKMP396mkmp00396
    • 2021-05-20
    122 min

    [NHDTB-534](Cum D***king Love And Entertainment) This College Girl Was Put Under A Spell, In Which She Would Love D***king Cum The More Cum She Drank, Until She Was Dominated In Body And Soul Into A Creampie-Hungry Bitch Who Wanted To Descend Into Th

  • censoredcreampieamateurNHDTBnatural highhopeless dainanaNHDTB-534NHDTB5341nhdtb00534
    • 2021-06-04
    123 min

    [NDRA-089]I'm Fucking My Girlfriend's Mom Without My Girlfriend Knowing... Yuri Oshikawa

  • yuri sugawa censoredbig titsmature womanNDRAjet eizomanji groupNDRA-089NDRA089ndra00089
    • 2021-06-10
    84 min

    [MMRAA-190]大沢麗菜 みるきーぷるん！

  • oosawa reina censoredsoloworkMMRAAspice visualMMRAA-190MMRAA190
    • 2021-06-12
    119 min

    [AUKG-514]Denim Maniacs H

  • nagatsuki natsuki shizuka sugisaki censoredlesbianAUKGu krentoAUKG-514AUKG514aukg00514
    • 2021-06-18
    36 min

    FC2PPV 1874485 Limited number [Uncensored] Road to a longing voice actor … Reality a few months after that … Creampie in big breasts of anime voice! !!

  • amateur uncensoredfc2
    • 2021-07-03
    60 min

    418YSS-85 Tsubasa

  • amateur censoredbig titsamateuryssyss-85yss85418yss-85
    • 2021-07-09
    122 min

    [UMD-786]Obstetrics And Gynecology!! 13 A Young Wife Who Doesn't Know ANything Is Called Into Treatment And Gets A Creampie!!

  • inaba nana maeno censoredbig titssquirtingUMDleodragon nishikawaUMD-786UMD786125umd00786
    • 2021-07-24
    41 min

    H4610 ki210724 Haruna Matsuoka 21years old

  • amateur uncensoredh4610
    • 2021-08-06
    125 min

    [DASD-900]My Wife Will Come Home Soon. Akari Mitani

  • mitani akari censoredcreampiesingle workDASDdasasagiri jouDASD-900DASD900dasd00900
    • 2021-08-12
    176 min

    [SW-792]With Nothing To Do In The Countryside, Of Course All Young People Will Do Is Fuck! And My Step-Cousins Who Have Developed Nicely, Come See Me For The First Time In A While And Want My Cock So I Give Them A Good Fucking!

  • censoredblowjobSWswitchraito fuji makotoswitch hibinoSW-792SW7921sw00792
    • 2021-08-21
    128 min

    [HOMA-108]My Middle-Management Job Was Leading Me Nowhere, But Then I Became Fuck Buddies With A Big Tittied Girl Who Works Under Me, Starring Hikari Sena

  • hikari sena censoredbig titssingle workHOMAh m p doramakc takedaHOMA-108HOMA108homa00108
    • 2021-08-29
    53 min

    292MY-458 Kawabata Emily 2

  • amateur censoredcreampiebig titsmymy-458my458292my-458
    • 2021-09-10
    120 min

    [IPX-717]112 Orgasms! 7300cc Of Squirts! A Big Ass Furious Ass-Shaking Piston-Pounding Trance Orgasmic Fuck Kotomi Ono

  • kotoyumi ono censoredsquirtingbeautiful girlIPXidea pocketinaballdishIPX-717IPX717ipx00717
    • 2021-09-11
    114 min

    [BABM-003]The Doting Step-Mom Ena Makes Me Feel Loved And Takes Care Of Me And When I Cry She Spoils Me With Sex Ena Koume

  • ena koume censoredcreampiebig titsBABMkaguya hime pt mousozokuyumesaki ichiroubabubabu no jitsuBABM-003BABM003babm00003



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download