amateur censored high vision kiss javcensored




FC2NNPJNACXAUKGMIDECJODLULUMIDVBBANAMBIFSDSSSTARSGVHCHRVPPPDMEYDHNDSPRDABWHZGDADN

2020-11-29
96 min

[VEC-454]My Mom's Best Friend Misa Kuroki

  • misa kuroki censoredcreampiebig titsVECvenusbingo tamatsukamegami venusVEC-454VEC454vec00454
    • 2020-12-02
    137 min

    [GVH-156]The Sexy PTA Chairwoman & A Mind-Blowing Hot Teacher Get Teamed By The S*****t Council Brats Ayane Sezaki/Mizuki Yayoi

  • ayane sezaki mizuki yayoi censoreddramaGVHglory questhyonGVH-156GVH15613gvh00156
    • 2020-12-03
    121 min

    [SHIC-175]Sugar Daddy Video SHIC- 175

  • sayano hiyori censoredsoloworkcosplaySHICshishunki.comSHIC-175SHIC175
    • 2020-12-19
    45 min

    FC2PPV 1612315 [Individual shooting] Local resident J system connected by SNS and Gachi Enko, plump thigh loli system and horny raw Paco [Creampie]

  • amateur uncensoredfc2
    • 2020-12-20
    146 min

    [HND-931]I Couldn't Meet With My Lady Boss So She Was Breaking In My Ass Remotely And We Conducted Mutual Masturbation For 30 Straight Days, And After That, We Released Our Pent-Up Lust With Creampie Sex. Yui Hatano

  • yui hatano censoredcreampieslutHNDhon nakajo asagiriHND-931HND931hnd00931
    • 2020-12-24
    124 min

    [FSDSS-142]Sweet, Seductive Whispered Dirty Talk - Office Girl Turns You On Sakura Tsukino

  • tsukino sakura censoredslutsingle workFSDSSfalenosatoshi maedafaleno starFSDSS-142FSDSS1421fsdss00142
    • 2021-01-01
    97 min

    [DOKS-533]Straddling Men's Faces To Show Off Their Panties & Pussy Gets Them Wet - Reverse Angle Masturbation

  • kasagi ichika mai takeda censoredschoolgirlDOKSoffice k sfechi nioffice ksDOKS-533DOKS53336doks00533
    • 2021-01-15
    160 min

    [MDBK-151]What a Coincidence! The Hooker They Sent Me Was the Girl I Jerked off to in High School! Cumming Ensues!! 5

  • nanase mona yuri fukada censoredcreampieschoolgirlMDBKbazookak taroMDBK-151MDBK151h-1496mdbk00151
    • 2021-01-15
    179 min

    [ZMEN-075]Amateur Cosplayer Gets D**gged, R**es, and Cums! 11

  • yamamoto renka yui satonaka censoredcosplayZMENz mennaveZMEN-075ZMEN075h-1371zmen00075
    • 2021-02-06
    120 min

    [SSNI-980]A Devilish Sugar Daddy Hunting Girl I Love My Boyfriend More Than Anything, But If It's For Money, I'll Turn On The Charm For A Middle-Aged Dirty Old Man And Fuck His Brains Out, And Here's The Footage To Prove It, From Start To

  • see the slope censoredbeautiful girlsingle workSSNIs1 no 1 stylemichiru arashiyamaSSNI-980SSNI980ssni00980
    • 2021-02-09
    32 min

    FC2PPV 1678496 [Personal shooting] Raw Gonzo of a beautiful wife who is far from everyday life. Thick sperm is poured and the inside of the vagina is violated.

  • amateur uncensoredfc2
    • 2021-02-11
    131 min

    [IENF-121]I'm A Loser With The Ladies, But Now This Criminally Devilish S********l Is Luring Me To Panty Shot Temptation, And Asking Me For Creampie Sex! She Wasn't Satisfied With Just One Fuck, So She Kept On Pressing Her Dripping Wet Pussy

  • aya mitsuki kisaragi mashiro censoredcreampieuniformIENFienergykikurinienfIENF-121IENF1211ienf00121
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-03-04
    62 min

    SIRO-4444 [First shot] [Awakening M] [Apology climax] A nursery teacher who has an adult sex appeal. Awakened her M spirit, she repeatedly cums many times with a humorous face that can not be seen by her children .. Application amateur, first AV shoo

  • amateur censoredbig titsamateursirosiro-4444siro4444siro-4444
    • 2021-03-06
    166 min

    [JUL-489]A Madonna Label Exclusive Kana Mito She's Lifting Her Lesbian Ban!! While On A Business Trip, To Her Surprise, She Was Booked Into The Same Room At The Business Hotel With Her Cute Colleague, Whom She Discovered, To Her Further Surprise,

  • kana mito ai mukai censoredlesbianmature womanJULmadonnanao masakiJUL-489JUL489jul00489
    • 2021-03-06
    62 min

    Caribbeancom 030621-001 Beautiful Bride – Creampie SEX on the eve of the wedding with the staff Miyuki Sakura

  • miyuki sakura uncensoredcreampiehandjobcaribbeancom
    • 2021-03-12
    32 min

    [CLO-133]Nipples On Tiny Titties. A Tiny Titty Barely Legal Babe And Her Shameful Nipples Konomi Kawana

  • konomi kawana censoredblowjobCLOchobitchchovicCLO-133CLO133h-1435clo00133
    • 2021-03-19
    120 min

    [SYKH-023]Dick Sucking Wife She Looks Sweet On The Outside But Is Actually A Complete Slut Miss Sara 35 Years Old

  • censoredcreampiemature womanSYKHleisurely missus emmanuelleSYKH-023SYKH023sykh00023
    • 2021-03-19
    100 min

    [VEC-470]My Friend's Mother And Me I Fucked Her Raw And Came Inside Of Her... Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiemature womanVECvenuspetermegami venusVEC-470VEC470vec00470
    • 2021-03-22
    245 min

    [AVS-024]AVS Collector's 2020 Annual SPECIAL BEST Catalogue

  • inaba natsuho imai censoredAVSavs collector savsAVS-024AVS024avs00024
    • 2021-03-31
    137 min

    [GVH-211]The Sexy PTA President, The Enchanting Female Teacher, And The Mischievous S*****t Council Rieko Hiraoka / Monami Takarada

  • rieko hiraoka takarada monami censoredmature womanGVHglory questhyonGVH-211GVH21113gvh00211
    • 2021-04-09
    120 min

    [DASD-848]A Woman Addicted To Throat Fucking

  • censoreddeepthroatDASDdasDASD-848DASD848dasd00848
    • 2021-04-14
    216 min

    [HUNTA-990]I Caught Two Of My Hottest Female Coworkers Making Out! They Were Kissing And Fucking Passionately, And When They Saw Me, They Let Me Join Them! After Our Work Party Was Over, The Two Of Them Brought Me Home, Too...

  • censoredcreampielesbianHUNTAhuntervolvo nakanohhh groupHUNTA-990HUNTA990hunta00990
    • 2021-04-23
    56 min

    328HMDN-356 [Personal shooting] Beautiful slender boss’s wife 48 years old and affair Gonzo. Creampie sex where a mature woman who turned into a slut releases her libido with a young man’s cock

  • amateur censoredcreampiebig titshmdnhmdn-356hmdn356328hmdn-356
    • 2021-04-29
    14 min

    HEYZO 2512 A Titty Fuck with Miya – Miya Izumi

  • miya izumi uncensoredblowjobcumshotheyzo
    • 2021-05-01
    141 min

    [BBAN-326]Lesbian Couples That Get Turned On By Swapping. I Get So Wet When Somebody Else Touches My Girlfriend's Body... Himari Kinoshita Suzu Monami

  • himari kinoshita himari hanazawa monami bell censoredlesbianBBANbibianBBAN-326BBAN326bban00326
    • 2021-05-11
    127 min

    [KMHRS-043]The Dream Of Meru's Most Devoted Follower: Licking And A First Creampie (Heart) - Meru Kusumi

  • kusumi censoredcreampieamateurKMHRSsod createtiger kosakaikimihoreKMHRS-043KMHRS0431kmhrs00043
    • 2021-05-15
    120 min

    [OMHD-007]Possessed And Entranced I Possessed The Body Of A Woman With A Full Body Erogenous Zone, And Experienced A Hyper Ecstatic Hard-Fucking Female Orgasmic Trip Ayaka Mochizuki

  • ayaka mochizuki censoredsquirtingblowjobOMHDdogmamigiwa otaOMHD-007OMHD007omhd00007
    • 2021-05-21
    120 min

    [HZGD-188]

  • kato camellia censoredcreampiebig titsHZGDmarried woman flower garden theaterhirokoji osakiimage married woman flower garden theatHZGD-188HZGD188h-1100hzgd00188
    • 2021-06-06
    60 min

    318LADY-377 Haruna

  • amateur censoredamateurbeautiful girlladylady-377lady377318lady-377
    • 2021-06-15
    92 min

    [GREDB-1026]Love Scandal / Hitomi Yoshikawa

  • censoredbig titsbeautiful girlGREDBcraneGREDB-1026GREDB1026h-706gredb01026
    • 2021-06-24
    120 min

    [HBAD-587]A Young Wife Innocently Seduces Men With Her Big Tits And Has Secret Adulterous Sex - Saeko Hiiragi

  • hiiragi saeko censoredbig titsblowjobHBADhibinoumanami jirobabeHBAD-587HBAD5871hbad00587
    • 2021-06-25
    30 min

    359TYVM-167 Saliva Exchange With Tongue Tangled Rich Berokisu Creampie Sexual Intercourse! !!

  • amateur censoredcreampiemarried womantyvmtyvm-167tyvm167359tyvm-167
    • 2021-07-05
    65 min

    493NAEN-068 None! ？？ Idol class Lori beautiful girl! ？？ Rin Kira throwing a big cock into 148 32

  • amateur censoredamateurbeautiful girlnaennaen-068naen068493naen-068
    • 2021-07-14
    120 min

    [GVH-265]A Stepmother And Her Stepchild Have Sex. Rieko Hiraoka.

  • rieko hiraoka censoredcreampiemature womanGVHglory questkisakura kabinGVH-265GVH26513gvh00265
    • 2021-07-19
    63 min

    10musume 071921_01 Trainee Actor’s Trial – Would the Cute Japanese Girl has Big tits Have Sex with Me？ Yuni Katsuragi

  • amateur uncensored10musume
    • 2021-07-20
    132 min

    [SDJS-120]SOD Female Employees Sasaki-san Is A Temp Worker Who Works In The General Affairs Department 26 Years Old "I Could Never Forget How Good It Felt ..." She's Volunteering For Duty, And Keeping It A Secret From Her Family! A One-Ti

  • natsuna sasaki censoredsquirtingamateurSDJSsod createakira saijosod female employeeSDJS-120SDJS1201sdjs00120
    • 2021-08-02
    50 min

    10musume 080221_01 Structure Of Woman: Please Measure My Body Full Of Tattoos Nagisa Miyabi

  • amateur uncensored10musume
    • 2021-08-06
    300 min

    [MUCD-250]Shooting Semen Into Her Cute Face! 20 Beautiful Girls End With Cum On Their Faces. 300 Minutes!

  • haruka suzumiya yuri fukada censoredblowjobbeautiful girlMUCDinnocentMUCD-250MUCD250mucd00250
    • 2021-08-06
    53 min

    C0930 ki210808 Miharu Kase 19years old

  • amateur uncensoredc0930
    • 2021-09-10
    214 min

    [HUNTB-093]"You"re Always Looking At My Tits, Aren"t You...？" A Quiet And Shy Plain Girl Close To Me Is Hiding Both Her Massive Tits And Her Intense Sexual Desires! And I"m The Only One Who Finds Out...

  • censoredcreampiebig titsHUNTBhuntercognac kaminohhh groupHUNTB-093HUNTB093huntb00093
    • 2021-09-16
    82 min

    [REBD-589]Megu The Real Face That Even My Husband Doesn"t Know

  • mio meg censoredsingle workREBDrebeccasawamura akiraREBD-589REBD589h-346rebd00589
    • 2021-09-29
    48 min

    FC2PPV 2268762 Limited [Uncensored] 147 Cm Small Animal F Cup Girl For The First Time Continuous Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-10-23
    117 min

    [MGMJ-052]Pantyhose and Beautiful Legs Freaks, Natsuki Nagahara

  • nagatsuki natsuki censoredslutsingle workMGMJmegamibijo shin fetishMGMJ-052MGMJ052mgmj00052
    • 2021-10-30
    58 min

    H4610 ki211031 Eri Sagawa 30years old

  • amateur uncensoredh4610
    • 2021-11-11
    60 min

    C0930 ki211111 Hikaru Ukita 19years old

  • amateur uncensoredc0930
    • 2021-11-19
    238 min

    [CJOB-100]Lavish Slick Slut"s Titty Rubbin" - Bathtime Handjob BEST Collection

  • julia shinoda yu censoredsluthandjobCJOBchijo heavenslut heaven bestCJOB-100CJOB100cjob00100
    • 2021-11-22
    66 min

    OREX-320 Sarina-San 4 (Sarina Momonaga)

  • amateur censoredcreampiebig titsorexorex-320orex320orex-320



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download