amateur censored high visio devil jav




FC2WANZVENUCAWDNGODLULUHMNIPXMIDEADNHODVGMEMMILKHDKAMEYDPPPDSQTEGVHVEMAMIDVSPRD

2020-11-26
44 min

FC2PPV 1584021 [Appearance / Uncensored] Miracle beautiful girl & transcendent beauty BODY Miri-chan has plenty of Echiechi service and flirting SEX large amount of semen bukkake w

  • amateur uncensoredfc2
    • 2020-11-27
    50 min

    FC2PPV 1586111 [First time limited 1980] Local 20-year-old hard student ❤️ Blow is good even if you are nervous ❤️ For life … Ojisan’s erection cock raw insertion ❤️ NO Contraceptive pussy with a large amount of vaginal ejaculation ❤️ * Rev

  • amateur uncensoredfc2
    • 2020-11-27
    115 min

    [PARATHD-3033]These College Girls Need Jobs - Their Scandalous Interviews At Paradise TV (2) - If You Want An Employment Offer, How About Taking Off Your Suits？

  • censoredamateurPARATHDparadise tvPARATHD-3033PARATHD3033parathd03033
    • 2020-12-05
    143 min

    [JUL-395]My Naughty Former Teacher Hired Me As A Callgirl And Made Me Into His Obedient Sex Pet... Mahiro Ichiki

  • mahiro ichiki censoredmature womansingle workJULmadonnajotaro tomiJUL-395JUL395jul00395
    • 2020-12-05
    66 min

    326MCC-001 Icharab date departs with an innocent small animal super cute AV actress! A semen shower is given to a beautiful girl who feels with plenty of private sex w

  • amateur censoredamateurbeautiful girlmccmcc-001mcc001326mcc-001
    • 2020-12-15
    64 min

    FC2PPV 1598673 [Yariman Hakata Musume] Airi [Individual shooting] I called Hakata Musume who had returned to her hometown in Corona ♪ Immediately in the car, a god-class handjob and a super sucking blowjob explode! Bring it home and poke it and shoot

  • amateur uncensoredfc2
    • 2020-12-17
    98 min

    [REBD-520]Ichika shop assistant performer - Ichika Mogami

  • ichika mogami censoredsingle workREBDrebeccakure hagaREBD-520REBD520h-346rebd00520
    • 2020-12-20
    87 min

    [SPZ-1087]I Never Thought She'd Fuck Me! My MILF Landlady

  • censoredamateurmature womanSPZstar paradisestar paradiesSPZ-1087SPZ1087h-254spz01087
    • 2020-12-24
    121 min

    [HAVD-1003]Kisses From Morning Until Night - Loving Lesbian Couples' Overnight Date

  • rumi tadami takanashi arisa censoredlesbianHAVDhibinodr torihamaHAVD-1003HAVD10031havd01003
    • 2021-01-01
    99 min

    [VEC-458]I Took The Hot Married Woman At My Part-Time Job Home For Creampie Sex Mako Oda

  • oda mako censoredcreampiebig titsVECvenusbingo tamatsukamegami venusVEC-458VEC458vec00458
    • 2021-01-15
    482 min

    [PYM-364]Self Shots: Fainting In Agony While Masturbating Collection: 100 Unequaled Married Women

  • censoredmarried womanPYMprimoPYM-364PYM364h-283pym00364
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-21
    169 min

    [NHDTB-483]Perverted Private Tutor Anal Fucks A S*****t To Encourage Her To Improve Her Grades 2

  • censoreduniformNHDTBnatural highlemonheart nakajimaNHDTB-483NHDTB4831nhdtb00483
    • 2021-01-29
    299 min

    [SCPX-417]I'm Alone With My Friend's Mother... "Hey Lady, Are You Thrusting Your Ass At Me In Order To Tempt Me？" 5 Hours

  • censoredcreampiebig titsSCPXscoophasshimousouzokuSCPX-417SCPX417h-565scpx00417
    • 2021-02-11
    56 min

    SIRO-4420 [First shot] [Tall x H cup x active JD] [Enchanted body that attracts men] A 21-year-old active university student who exposes a fascinating perfect body. Attract serious pant to the pleasure that becomes intense .. AV application on the ne

  • amateur censoredbig titsamateursirosiro-4420siro4420siro-4420
    • 2021-02-19
    49 min

    FC2PPV 1692862 [No / piece] “Don’t you call me anymore？” Sakura-chan, a nursery teacher who came to SEX ignoring her boyfriend’s phone, put a large amount of vaginal cum shot in a minimum pussy holding a big cock that can not fit

  • amateur uncensoredfc2
    • 2021-02-25
    464 min

    [NHDTB-496]She Was A Post-Birth Virgin Who Was Deflowered A Second Time, And Once She Started Cumming Again, This Baby Carriage-Pushing Wife Kept On Spasming Endlessly For Hours 7 This 2-Disc Special Cums With Highlights

  • censoredmarried womansquirtingNHDTBnatural highjacken kodamaNHDTB-496NHDTB4961nhdtb00496
    • 2021-02-27
    117 min

    [MIAA-400]They Won't Let You Stop Until You've Cum 10 Times! - This Naughty Soapland Girl Pushes Masochistic Guys Past Their Ejaculation Limits - Riho Fujimori

  • riho fujimori censoredbig titsslutMIAAmoodyzdragon nishikawaeveryone s porn starMIAA-400MIAA400miaa00400
    • 2021-02-27
    149 min

    [FONE-136]The Non-nude Erotica Of A Big Breasted, Fiery Girl: On The Day Of Shooting, She Gives An Electrifying AV Appearance - Rio

  • censoredcreampiebig titsFONEfirstplusFONE-136FONE136h-491fone00136
    • 2021-03-25
    57 min

    SIRO-4464 [First shot] [Beautiful nude with huge breasts and Momojiri] [Superb suction service] A busty clerk working at an apparel store in Shin-ku, Tokyo. She is obedient and shows off even ornamental masturbation .. AV application on the net → AV

  • amateur censoredbig titsamateursirosiro-4464siro4464siro-4464
    • 2021-05-01
    118 min

    [CLOT-018]Pantyhose Temptation Aida Usagi

  • aika usagi censoredcreampiesingle workCLOTplanet plusdirector ocloseCLOT-018CLOT018h-237clot00018
    • 2021-05-16
    128 min

    [MXGS-1185]Lovey Dovey Sex With Huge F***eful K-Cup Tits Bouncing Here And There Yua Makura

  • yu asakura censoredcreampiebig titsMXGSmaxingMXGS-1185MXGS1185h-068mxgs01185
    • 2021-05-22
    159 min

    [FLAV-269]Huge Tits With Erect Nipples Older Woman With A Huge Ass And Sexy Areolas On Her Big Tits Is A Seductive Nympho Slut Shiori Tsukada

  • shiori tsukada censoredsingle workbukkakeFLAVdigital arkdigital ark digital arkFLAV-269FLAV269flav00269
    • 2021-05-26
    49 min

    481SACZ-033 Yuko 5

  • amateur censoredmarried womanamateursaczsacz-033sacz033481sacz-033
    • 2021-06-10
    119 min

    [FSDSS-236]I Tried And Tried And Tried To Resist, But Finally I Could No Longer Resist, And I Succumbed To The Lure Of Forbidden Sex With My Girlfriend's Little Sister, And Fucked Her For 2 Days, And Nobody Must Every Know About It. Sora Amakawa

  • tenkawa sora censoredbig titsblowjobFSDSSfalenomanyufaleno starFSDSS-236FSDSS2361fsdss00236
    • 2021-06-16
    121 min

    [OVG-173]My Aunt Came To Visit Me In The Hospital And Carelessly Accidentally Flashed Her Tits, Giving Me An Instant Huge Erection! Auntie Takes Full Responsibility By Riding Me Cowgirl Style And Milking Me Of Every Last Drop Of Cum

  • yui hatano yuri sugawa censoredcreampiebig titsOVGglory questOVG-173OVG17313ovg00173
    • 2021-06-26
    123 min

    [JUTA-119]First Class!! Wife In Her Forties' First Nude AV Documentary Asami Miyase

  • asami miyase censoredcreampiebig titsJUTAjukujo japanmusei tokugawaJUTA-119JUTA119juta00119
    • 2021-07-10
    127 min

    [KYMI-013]Pin-Up Slut

  • hamazaki mao suzuki mayu censoredslutKYMImiluaida yumenoKYMI-013KYMI013kymi00013
    • 2021-07-30
    66 min

    383REIW-086 Hime

  • amateur censoredcreampiebig titsreiwreiw-086reiw086383reiw-086
    • 2021-08-16
    71 min

    [MISG-003]Creampie Sex With A Girl Who Is Annoyed For Some Reason And Treats Me Coldly Yu Shinoda

  • shinoda yu censoredcreampiebig titsMISGstimulation strongjohnny shibuyaMISG-003MISG003misg00003
    • 2021-08-18
    50 min

    FC2PPV 2040117 [No] [Appearance] [Review Benefits] Perfect Beauty Body Amateur Girl, Second Time Because Of Popularity ♡ Gonzo Cum Shot With Oil Massage ☆ Meet In The Car And Shoot In The Car Mouth ☆

  • amateur uncensoredfc2
    • 2021-08-26
    63 min

    Pacopacomama 082621_523 Mature Lady Piledriver Position BJ : Maki Sekiguchi

  • amateur uncensoredpacopacomama
    • 2021-09-08
    120 min

    [FTDSS-004]"My Name Is Yoko Tsukasa" First Appearance! Beautiful White Slender Body And Super Intimate Service First Experience Soapland

  • yoko tsukasa censoredFTDSSfalenoeizo mochizukifaleno tubeFTDSS-004FTDSS0041ftdss00004
    • 2021-09-10
    180 min

    [FFFS-031]Taking MILFs Back Home For A Fuck! Married Sluts Ride Other Men"s Dicks - Caught On Hidden Camera 28 - Horny Working Nympho Wives Can"t Help Themselves - Ms Satsuki, H-Cup, Age 42, Born Slut Horny Every Day - Ms Masami, E-Cup, Age 3

  • censoredmature womanslutFFFSprivate mousozokugroupFFFS-031FFFS031fffs00031
    • 2021-09-24
    156 min

    [CJOD-313]Lewd Older Sister Turns Into A Slut For A Creampie. Rejuvenating Asian Men"s Massage Parlor. Luna Tsukino

  • tsukino luna censoredcreampieslutCJODbioosaki hirokoujichijo hebunCJOD-313CJOD313cjod00313
    • 2021-10-04
    90 min

    DCH-014 Ria (Yuria Yoshine)

  • amateur censoredcreampiebig titsdchdch-014dch014dch-014
    • 2021-10-17
    115 min

    420HOI-168 Pretty (21) Amateur Hoi Hoi Z, Amateur, 4th Year College Student, Neat, Big Tits, Outstanding Style, Graceful, Sensitive, Beautiful Girl, Slender, Beautiful Breasts, Tall, Gonzo (Azusa Natsuai)

  • amateur censoredbig titsamateurhoihoi-168hoi168420hoi-168
    • 2021-11-03
    73 min

    435MFC-155 [4 Shots In Total! Big Tits Yariman Bitch Advent Who Devours His Friend With Unfathomable Libido] G Cup Big Tits With A Neat Face Ntr! "No Money Or Sex Technique Is Better Than Me!" Overconfidently Execute A Plan To Make A Friend&#

  • amateur censoredcreampiebig titsmfcmfc-155mfc155435mfc-155
    • 2021-11-16
    134 min

    [KTRA-344]Creampie In The Shaved Pussy Of A Girl With A Step-Father Complex Who Loves To Please Haru Yamaguchi

  • haru yamaguchi censoredcreampiebeautiful girlKTRAk tribeKTRA-344KTRA344
    • 2021-11-16
    59 min

    SIRO-4669 [First Shot] [Elegant Appearance] [Sigh That Leaks Indecently] Politeness ○ A Beautiful Tutor Who Has Both Wisdom And Bewitching Advent. The Intense Piston From Her Back Writhes Her Outstanding Style, And While She Has An Ecstatic Expressio

  • amateur censoredamateursirosiro-4669siro4669siro-4669
    • 2021-11-18
    265 min

    [AKDL-152]You Can"t Resist A Gorgeous Girl In A Tight Dress - Time For A Quickie! Pounded Hard Right Down To Her Womb For An Incredible Orgasm - Highlights Collection

  • kanna misaki shinoda yu censoredbig titsAKDLaquinoriaknrAKDL-152AKDL1521akdl00152
    • 2021-11-21
    96 min

    SRH-022 Kyoko (Meru Ito)

  • amateur censoredamateursrhsrh-022srh022srh-022
    • 2021-11-24
    80 min

    259LUXU-1498 Luxury TV 1487 A Company Owner With An Attractive Whip Whip Glamorous Body Appears For The Second Time! A Plump Body That Shines Bewitchingly With Oil. Big Tits Are Shaken By A Violent Piston And It Is Disturbed! !! (Ayase Dew Pear)

  • amateur censoredbig titsamateurluxuluxu-1498luxu1498259luxu-1498
    • 2021-12-17
    124 min

    [PPPD-989]Riho Fujimori, Spence Breast Development Clinic

  • riho fujimori censoredcreampiebig titsPPPDoppaiPPPD-989PPPD989pppd00989
    • 2021-12-17
    92 min

    467SHINKI-070 "Depaga" [Train Molester] [Home Voyeur] [Sleep Fuck] Black Tight Knit Pink P (Of Yuki)

  • amateur censoredcreampieamateurshinkishinki-070shinki070467shinki-070
    • 2021-12-18
    41 min

    C0930 ki211219 Emi Sakai 26years old

  • amateur uncensoredc0930
    • 2021-12-23
    56 min

    413INST-194 [Aphrodisiac Shisha] H cup big breasts ♀ (22) who loves penis and raw SEX with the best pleasure. Just insert it and it’s a continuous demon acme with estrus pussy! Appeal for vaginal cum shot in 30 minutes! (Miki Sanada)

  • amateur censoredcreampiebig titsinstinst-194inst194413inst-194
    • 2021-12-31
    119 min

    [ADN-365]Instructor Ayako Came To The Judo Training Camp Deep In The Forest To Be A Special Advisor, Now We"re Giving Her Amazingly Vigorous Sex (Lol). Kana Kusakabe

  • kana kusakabe censoredbig titssingle workADNattackerskitorune kawaguchiotona no dramaADN-365ADN365adn00365



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download