aki sasaki




FC2JULEBODKSBJNNPJHZGDWAAAVEMACAWDHODVRBDCJODMIDESQTEPREDSPRDFSDSSDTTNACRAVSAIPX

2020-12-12
120 min

[IPX-588]Super Fellatio SP When Minami Sucks Cock It Feels Better Than Her Vagina Minami Aizawa

  • minami aizawa censoredblowjobslutIPXidea pocketinaballdishIPX-588IPX588ipx00588
    • 2020-12-21
    117 min

    [CESD-960]Yui Hatano x Lena Aoi These Ladies Are Getting Down And Dirty And Letting The Truth Cum Out, And Then They Fall In Love... Witness Deep And Rich Hard For-Real Lesbian Sex!

  • yui hatano blue censoredlesbianmature womanCESDceleb no tomoCESD-960CESD960cesd00960
    • 2020-12-24
    241 min

    [ZOOO-015]20 Ladies With Exquisite Bodies 2 240 Minutes With Beautiful Ladies With Beautiful Big Tits And Faces That Alone Would Be Enough To Provide You With Ample Nookie

  • aika kimishima mio censoredbig titsZOOOzoooZOOO-015ZOOO015h-1515zooo00015
    • 2020-12-28
    61 min

    468NRPK-010 Mugi (20)

  • amateur censoredamateurbeautiful girlnrpknrpk-010nrpk010468nrpk-010
    • 2021-01-16
    48 min

    FC2PPV 1646740 Female Announcer Nasty Beauty Yui-chan-Since it was a swimsuit under the uniform, raw vaginal cum shot as it is

  • amateur uncensoredfc2
    • 2021-01-19
    72 min

    FC2PPV 1651512 I messed up my slender innocent girl with Lady Gras until it got crazy ~ ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-01-23
    46 min

    450OSST-007 The sober girl I found in Korea was a wasteful beauty with hidden big breasts and a beautiful look hidden with glasses! The self-proclaimed C cup and the hidden big breasts that lie modestly are good to massage! It’s okay to shake!

  • amateur censoredbig titsamateurosstosst-007osst007450osst-007
    • 2021-02-05
    242 min

    [SCR-264]Barely Legal Teens G*******ged By Grown Ups On Camera 4 Hours

  • censoredcreampiebeautiful girlSCRglay zs crimeSCR-264SCR26412scr00264
    • 2021-02-05
    243 min

    [MMB-350]Daydream Slut

  • misono waka scolding censoredbig titsbeautiful girlMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-350MMB350mmb00350
    • 2021-02-19
    129 min

    [OMHD-004]Erotic Possession - Your Wish For A Woman's Body Has Come True Rika Aimi

  • rumi tadami censoredbig titslesbianOMHDdogmamigiwa otaOMHD-004OMHD004omhd00004
    • 2021-02-28
    145 min

    [KTKC-108]Miyu-pon Is A Karate Master Tuber Who Likes To Toy With Men's Hearts, Because She's A "Cunning And Erotic Bitch" She's A Black Belt, But Usually She's A Maso And Obedient Sex Pet And Now This Video Is Being Released

  • censoredbig titsamateurKTKCkitixx mousouzokubig titsKTKC-108KTKC108ktkc00108
    • 2021-02-28
    76 min

    200GANA-2448 Seriously Nampa, first shot. 1604 Hotel IN at Tay who picks up an older sister with beautiful legs and listens to consultations! Frustrated when she touches her body while consulting her troubles, she is gradually swept away, opens her l

  • amateur censoredamateurganagana-2448gana2448200gana-2448
    • 2021-03-04
    62 min

    [KBTV-068]A Married Woman Shows A Side Of Herself That Her Husband Never Gets To See Misako-san

  • censoredcreampiebig titsKBTVfirst av appearanceKBTV-068KBTV068h-244kbtv00068
    • 2021-03-25
    60 min

    Caribbeancom 032521-001 Quick Shooting: The Best of Mika Aoki

  • mika aoki uncensoredcreampiecaribbeancom
    • 2021-04-09
    121 min

    [MDTM-718]Full POV Quickie Impregnation Sex Submissive Maid Aoi Nakajo

  • nakagusuku censoredcreampiebeautiful girlMDTMuchu kikakutodoMDTM-718MDTM718mdtm00718
    • 2021-04-14
    124 min

    [PPPD-920]The Spence Gland Development Clinic Maron Natsuki

  • marin natsuki censoredcreampiebig titsPPPDoppaiPPPD-920PPPD920pppd00920
    • 2021-04-22
    120 min

    [FSDSS-214]Ultra Pleasurable Breath Holding Fetish And Exhilarating Sweaty Facials Noa Miura

  • miura noai censoredbig titsbeautiful girlFSDSSfalenotake dfaleno starFSDSS-214FSDSS2141fsdss00214
    • 2021-04-24
    30 min

    492JCHA-021 I want a woman to talk to me 3

  • amateur censoredschoolgirlamateurjchajcha-021jcha021492jcha-021
    • 2021-04-27
    41 min

    Pacopacomama 042721_465 Cum On Tits Special: Natsuki Kikuta, Yuki Shinoda, Nanako Asahina

  • amateur uncensoredpacopacomama
    • 2021-05-01
    118 min

    [SSIS-053]Big Titty Y********l Who Works At A Bar In The Country Side Has Nothing To Do But Party And Have Sex After She Misses The Last Train Miharu Hanesaki

  • miharu hanasaki censoredbig titsblowjobSSISs1 no 1 stylekitorune kawaguchiSSIS-053SSIS053ssis00053
    • 2021-05-08
    61 min

    383REIW-063 Mitsuki

  • amateur censoredcreampieamateurreiwreiw-063reiw063383reiw-063
    • 2021-05-22
    123 min

    [AVSA-167]Slutty Girl With A Sexy Tongue AIKA

  • aika censoredslutsingle workAVSAavs collector sbuddha davscollector sAVSA-167AVSA167avsa00167
    • 2021-06-28
    36 min

    FC2PPV 1891788 First shot! !! Limited number [Uncensored] Creampie twice to a super-nasty manicurist with husky voice! !! (Feature film)

  • amateur uncensoredfc2
    • 2021-07-16
    240 min

    [OYAJ-179]Wombs Pounded Deep And Hard Until They Cum

  • amateur censoredamateurmature womanOYAJseishunshaOYAJ-179OYAJ179
    • 2021-07-24
    145 min

    [JKSR-502][Leaked Images] Girls at Training Camps for their Clubs in Sex, Sucking, 3P, Voyeurism While Changing...Many other Horny Videos.

  • censoredschoolgirlamateurJKSRbig morkalprink junkyJKSR-502JKSR50257jksr00502
    • 2021-07-27
    102 min

    SHPV-001 Momoasu

  • amateur censoredamateurbeautiful girlshpvshpv-001shpv001shpv-001
    • 2021-08-06
    63 min

    SIRO-4574 [First Shot] [Blow Job With A Horny Sound] [Amazing Continuous Iki] An Active JD With A Wonderfully Cute Shy Reaction. The Body On The Verge Of An Outburst That Has Been Overtaken By Masturbation Exposes Continuous Death Many Times .. Appli

  • amateur censoredamateursirosiro-4574siro4574siro-4574
    • 2021-08-06
    174 min

    [JUNY-041]This Perky J-Cup"s Always Wearing A Smile And She"ll Stun You With Her Dazzling Gaze! In These Troubled Economic Times, She Can"t Seem To Hold Down A Job... So This Formed Synchronized Swimmer College Girl With Colossal Tits And

  • censoredbig titsJUNYfitchnikuyokuJUNY-041JUNY041juny00041
    • 2021-08-13
    120 min

    [SSIS-147]"Sorry Dear..." For The 7 Days That My Husband Was On A Business Trip, My Husband"s Boss That I Hate Fucked Me Like Crazy... Yura Kano

  • yura kanno censoredsingle workSSISs1 no 1 styleasagiri jouSSIS-147SSIS147ssis00147
    • 2021-08-17
    60 min

    Caribbeancom 081721-001 When I Returned To Office With A Wet Heavy Rain Showers, My Sexual Harassment Boss Had Sex With Me Rena

  • rena uncensoredcreampiehandjobcaribbeancom
    • 2021-08-24
    146 min

    [JMTY-057]# Support File 02 Reina (Hotel Play 3) This Big Tits Beauty Came During Business Hours As A Temporary Part-Time Worker, So I Made Her D***k My Cum And Creampie Fucked Her

  • censoredcreampiebig titsJMTYteacher delusion groupukyo lifeJMTY-057JMTY057jmty00057
    • 2021-08-31
    142 min

    [KUSE-025]One"s Not Enough! Can"t Stop At Just One Cum Load! Cum Hungry Slut Demands Endless Dicks And Cum Loads For Sexual Ecstasy! 21 Cum Loads Total! Plus One Male Squirting. Asami Jun

  • asami jun censoredsoloworkslutKUSEsod createsandmanjoyuu no kuse ga sugoiKUSE-025KUSE025
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-19
    50 min

    523DHT-0297 36 Years Old Living In Roppongi Creampie For Her Sister Wife Her Erika 36 Years Old

  • amateur censoredcreampiemarried womandhtdht-0297dht0297523dht-0297
    • 2021-09-24
    120 min

    [JUL-725]Rin, The Stepmom Of Two Good-for-nothing Sons, Is Used By Them To Process Their Libidos. Rin Okae

  • rin okae censoredmature womansingle workJULmadonnayo sukeJUL-725JUL725jul00725
    • 2021-10-07
    178 min

    [NHDTB-585]This Precocious J* Is Getting An Adult Awakening Through An Anal Massage From Her Perverted Step Uncle

  • censoredschoolgirlNHDTBnatural highremonha to nakashimaNHDTB-585NHDTB5851nhdtb00585
    • 2021-10-09
    138 min

    [CEAD-370]Ema Kuon"s One Off Adult Debut: Her First Time Experiencing Total Climax And Trembling From A Massive Cock!

  • emma kuon censoredblowjobmature womanCEADserebu no tomoCEAD-370CEAD370cead00370
    • 2021-10-09
    83 min

    300NTK-644 [W Beauty Bitch’s Summit Battle! !! Rocket Milk VS Purijiri Slender W Bitch Competition Big Orgy! !! ] Supreme VS Ultimate! !! Dochashiko Smashing Orgy 4P! !! Rocket Milk Gal And Slender Gal Of Course W Bitches! !! Betting The Pride O

  • amateur censoredcreampiebig titsntkntk-644ntk644300ntk-644
    • 2021-10-20
    66 min

    SIRO-4671 [First Shot] [Sensitive Constitution That Gets Wet] [M Nature That Is Revealed] A Beautiful Receptionist Who Creates A Fluffy Soft Healing Aura. A Sensitive Body That Seems Pure And Has A Gentle Appearance Wets Her Underwear Thoroughly Just

  • amateur censoredamateursirosiro-4671siro4671siro-4671
    • 2021-10-21
    125 min

    [HAVD-1013]Hot Smothering Kisses! Horny Best Friend Lesbian Series - Endless Horny Raw Lesbian Sex

  • kagami sara mahiro ichiki censoredlesbianHAVDhibinodr torihamaHAVD-1013HAVD10131havd01013
    • 2021-10-23
    61 min

    HEYZO 2645 Baby-Faced Married Wife Was Cuckolded At Swimming Class – Hina Hodaka

  • hina hodaka uncensoredcreampieblowjobheyzo
    • 2021-10-26
    130 min

    [SAN-026]The Tragic Story Of A Woman Whose Ex-Husband Left Her With So Much Debt That She Couldn"t See Straight. Akira Mimori

  • akira mimori censoredcreampiesingle workSANmazagod maramother mazaSAN-026SAN026h-796san00026
    • 2021-11-15
    56 min

    230OREC-933 Kazuna (Kazuna Yuki)

  • amateur censoredcreampiebig titsorecorec-933orec933230orec-933
    • 2021-11-16
    76 min

    299EWDX-388 G Cup Big Breasts Wife’s Healing Fucking Famous Instrument Ma Co ○ Cum Inside Raw Saddle

  • amateur censoredcreampiebig titsewdxewdx-388ewdx388299ewdx-388
    • 2021-12-06
    51 min

    230OREC-947 Miku

  • amateur censoredcreampiebig titsorecorec-947orec947230orec-947
    • 2021-12-06
    53 min

    326KSS-001 [Super Erotic Conceived Body! !! ] Two Consecutive Vaginal Cum Shots That Pour Sperm Into A Dirty Dress That Looks Good On A Tight Dress Until It Becomes A Gold Ball! !! (Erika Fujiwara)

  • amateur censoredcreampiebig titsksskss-001kss001326kss-001
    • 2021-12-09
    60 min

    336KNB-184 [Former Gravure Married Woman Advent] Even Though I Applied For It Myself, I Was Sick Of Cheeky Attitude From Beginning To End, So I Raped My Beautiful Body And Made Vaginal Cum Shot! I Felt Like It Was A Kettle And Messed Up, And I Think

  • amateur censoredcreampiemarried womanknbknb-184knb184336knb-184
    • 2021-12-11
    135 min

    [DVAJ-549]Pussy-Pounding Piston Cowgirl Sex To Get Her Cunt Foaming With Bodily Fluids, So She Can Give His Dripping Wet C*ck Another Blowjob, And Another Round Of PToM Sex Into Her Welcoming P*ssy Nonoka Sato

  • is it sato momoka kato censoredcreampieblowjobDVAJalice japanakai suiseiDVAJ-549DVAJ549dvaj00549



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download