yumi




FC2HUNTBAUKGVEMAMIDEAVSAMIAASQTEMIDVHMNMEYDDTTCAWDDASDNACXONEZSSNIADNMILKMARASAN

2020-12-03
61 min

FC2PPV 1593139 300pt OFF for a limited time [No / piece] “… I’ve come to like big ♡♡♡” My lover in my heart !？ After the first date with Nanami who is injured at a marriage party, overwriting SEX that makes me forget my ex-boyfrie

  • amateur uncensoredfc2
    • 2020-12-19
    59 min

    H0930 ki201220 Shigemi Sendou 44years old

  • amateur uncensoredh0930
    • 2020-12-20
    118 min

    [NNPJ-424]Broke Girl Just Lost Her Job - Tempted By The Offer Of A High-Paying Temp Contract, She Agreed To Be A Bare-Breasted Maid And Before She New It Her Colossal Tits Had Seduced The Man Who Hired Her Into Banging Her! Plenty Of Play With Her I-

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-424NNPJ424nnpj00424
    • 2020-12-21
    117 min

    [CESD-960]Yui Hatano x Lena Aoi These Ladies Are Getting Down And Dirty And Letting The Truth Cum Out, And Then They Fall In Love... Witness Deep And Rich Hard For-Real Lesbian Sex!

  • yui hatano blue censoredlesbianmature womanCESDceleb no tomoCESD-960CESD960cesd00960
    • 2021-01-12
    236 min

    [MQSM-001]Hot And Horny Human Doll: The Legendary Orgasm Files - Female Body Being Made To Cum Relentlessly Under The Blazing Sun

  • censoredbeautiful girlMQSMmercuryecstasy ismMQSM-001MQSM001h-1133mqsm00001
    • 2021-01-15
    237 min

    [SIM-105]"Hey Teacher, Let's Hurry Up And Fuck" This Private Tutor Is An Excessively Devilish Mofo Who Is Luring His Sch**lgirl Pupil To Temptation, And When They Fuck, He Doesn't Even Bother To Put On A Rubber, And Goes For A Totally

  • censoredcreampieuniformSIMprestigeamateur pussiesSIM-105SIM105118sim00105
    • 2021-01-22
    240 min

    [MBM-266]mpo.jp Presents The Nonfiction Amateur Nampa Seductions Divine Best Hits Collection (Time-Saving Quickie Fucks Featuring Prematurely Ejaculating Ladies) 12 Ladies 4 Hours

  • censoredsquirtingamateurMBMprestigempo selection.committeembmMBM-266MBM266118mbm00266
    • 2021-01-23
    52 min

    FC2PPV 1656863 [Personal shooting] First shot & first vaginal cum shot ★ Luna 20-year-old maid cafe clerk! I will do the first vaginal cum shot and Gonzo in my life.

  • amateur uncensoredfc2
    • 2021-02-06
    597 min

    [OFJE-296]Mixed Body Fluids, Deep Sex - Latest 12 Titles, 51 Scenes, Complete 10-Hour BEST Collection

  • nanatsumori riri kodama rena censoredbig titsOFJEs1 no 1 styleOFJE-296OFJE296ofje00296
    • 2021-02-11
    60 min

    Caribbeancom 021121-001 Quick Shooting: The Best of Aira 2 Aira

  • aira uncensoredcreampiehandjobcaribbeancom
    • 2021-02-17
    81 min

    FC2PPV 1689768 [Personal shooting / set sale] Wife who struggles between pride and pleasure Complete version

  • amateur uncensoredfc2
    • 2021-02-17
    116 min

    [pow-040]くちく☆逆バニー

  • amateur censoredbig titsamateurpowpow-040pow040pow-040
    • 2021-02-19
    98 min

    [LBDD-001]Tsubasa Akimoto / Girlfriend

  • akimoto tsubasa censoredbeautiful girlsingle workLBDDmedia brandgirlfriendsLBDD-001LBDD001301lbdd00001
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-03-05
    67 min

    SIRO-4445 [First shot] [For your favorite band ..] [Slender x nice ass] Back part-time job started for your favorite band. Contrary to the appearance that seems to be pure, the sensitive girl who was hiding her sullen propensity .. Application amateu

  • amateur censoredamateursirosiro-4445siro4445siro-4445
    • 2021-03-11
    131 min

    [IENF-129]Picking Up Party Girls With The Offer Of A Free Massage! Bratty Sluts Seduced With An Erotic Massage Get So Horny They Cum Like Crazy And Quickly Transform Into Raging Nymphos Made To Take Creampies

  • natsuho imai misuzu kawana censoredcreampieIENFi energyienfIENF-129IENF1291ienf00129
    • 2021-03-12
    34 min

    FC2PPV 1723596 [Amateur huge breasts] Nana-chan is pregnant with the second vaginal cum shot sex in her life？ Rocket boobs H cup nursery teacher 22 years old ♪ Creampie semen that I put up with for a month! 4K high image quality with vaginal cum shot

  • amateur uncensoredfc2
    • 2021-03-13
    110 min

    [VEMA-159]Naughty Teacher Makes A House Call, But Her S*****t's Parents Aren't Home - Tongue-Lavishing French Kiss Seduction Nao Nakano

  • nanao nakano censoredcreampiebig titsVEMAvenuskaniemegami venusVEMA-159VEMA159vema00159
    • 2021-03-18
    75 min

    326URF-061 [Back customs x erotic god GAL advent ☆] The best gal with a personality that kills sperm with full service! Sensation with lewd Kansai dialect ⇒ Paipanma ● 4 shots with SEX swamp loop of vaginal cum shot! !! After all, the hit lady is a b

  • amateur censoredcreampiebig titsurfurf-061urf061326urf-061
    • 2021-04-06
    122 min

    [KTRA-286]My Big Tits Little Stepsister Lured Me To Temptation With Creampie Sex Akane Shiki

  • akane shiki censoredbig titsuniformKTRAk tribeKTRA-286KTRA286h-094ktra00286
    • 2021-04-14
    162 min

    [DVDMS-655]Ordinary Guys And Girls Caught On Camera - Coworkers With Colossal Tits Get Tipsy, Hit On Their Boss, And Make Him Give Them Creampie Fucks Until Dawn (Role Reversal) 2

  • censoredcreampiebig titsDVDMSdeep sswing nagaseDVDMS-655DVDMS655dvdms00655
    • 2021-04-23
    61 min

    Caribbeancom 042321-001 Look At Me having SEX! and Jerk Off On My Face! 3 Rena

  • rena uncensoredcreampiehandjobcaribbeancom
    • 2021-04-24
    118 min

    [HOKS-095]The Life Of A Middle Aged Couple Who Get Along With Each Other

  • yuka hirose kyoko kubo censoredmature womandramaHOKSfa prokinzo ogurokkuHOKS-095HOKS095hoks00095
    • 2021-05-22
    127 min

    [AGAV-055]

  • usui ren censoredbig titsblowjobAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-055AGAV055agav00055
    • 2021-05-25
    65 min

    499NDH-019 An advancing addict who eats a man with his upper and lower mouths! This cowgirl won a great grand prize! !! Belochu LOVE carnivorous demon sexual desire is attacked and behaves in a big way! I thought that I was chin-pressed, but immediat

  • amateur censoredsquirtingamateurndhndh-019ndh019499ndh-019
    • 2021-05-30
    78 min

    300NTK-579 Black GAL x Swimsuit x Bitches! !! Dream Black Gal SEX Festival Gangbang 4P Opening! !! Super-dreadnought brown bottle cans Beautiful breasts gal’s squirting squirting Outdoor ascension and the pool is squirting! !! Sexual Defense Eve

  • galp censoredcreampiesquirtingntkntk-579ntk579300ntk-579
    • 2021-06-18
    64 min

    300NTK-589 H Cup Dirty Tits Gal Love SEX! !! Wet with alcohol and tech Chastity idea Hikuhiku Eroman! !! This is a 100-year-old training blame with a blowjob of Yariman high technique! !! Big Breasts Ero Gal is an Offense Strong Defense Super Yowa is

  • amateur censoredcreampiebig titsntkntk-589ntk589300ntk-589
    • 2021-06-24
    121 min

    [FSDSS-247]A Bubbly Cosplayer Attacks Guys' Nipples - Nori Kawanami

  • real village henan censoredcosplaybeautiful girlFSDSSfalenotake dfaleno starFSDSS-247FSDSS2471fsdss00247
    • 2021-06-26
    244 min

    [MCSR-441]Forbidden Sexual Nursing Caregivers Who Enjoy Taking Care Of What's Below The Belt 10 Girls 4 Hours

  • sumika nagao sakura censoredgrandfatherMCSRbig morkalsaburo kamegashimamascottMCSR-441MCSR44157mcsr00441
    • 2021-07-01
    58 min

    324SRTD-0237 OK sign if your drinking friend is drunk! I got angry when I made a vaginal cum shot w

  • amateur censoredcreampieamateursrtdsrtd-0237srtd0237324srtd-0237
    • 2021-07-02
    68 min

    520SSK-010 Ai

  • amateur censoredcreampieuniformsskssk-010ssk010520ssk-010
    • 2021-07-03
    97 min

    200GANA-2521 A real record of how even beginners can easily take home on the same day! <Be sure to watch> You can have sex with you! !!

  • amateur censoredbig titsamateurganagana-2521gana2521200gana-2521
    • 2021-07-20
    63 min

    H4610 ki210720 Youko Higashi 21years old

  • amateur uncensoredh4610
    • 2021-08-13
    162 min

    [BLK-511]Convenient Free Pussy! Fucking Raw Till Morning With A Horny Bitch Who Loves Older Men 07

  • censoredcreampiesquirtingBLKkira kirakira hosi kira black galBLK-511BLK511blk00511
    • 2021-09-16
    134 min

    [IORA-009]"Those Filthy Extra Hairs, Fluttering In Breeze, Are Absolutely Not Unnecessary!" This Beautiful Married Woman Is Lifting Her Arms Up In A Banzai Pose, Exposing Her Underarm Hairs, And Enjoying Creampie Sex!! Here Is Suzune Ozawa, 3

  • suzune ozawa censoredcreampiemarried womanIORAcenter villagejiro fukagawazora center villageIORA-009IORA009h-086iora00009
    • 2021-09-17
    240 min

    [DVDMS-716]A Normal Boys And Girls Focus Group Adult Video A College Girl Big Stepsister And Her Little Stepbrother Are Taking The Thrilling 24-Hour Roulette Life Challenge! This Big Stepsister And Her Little Stepbrother Spin The Wheel And Complete E

  • censoredcreampieamateurDVDMSdeepspoolsidedeep sDVDMS-716DVDMS716dvdms00716
    • 2021-10-16
    13 min

    FC2PPV 2351683 [Monashi ★ Appearance] Monassy Extra Edition ♪ Challenge The Taboo Of Customs With A Gal-Type Delivery Health Girl With A Tongue That Was Called With A Shooting Option! Gonzo Cum Shot During The 60-Minute Course!

  • amateur uncensoredfc2
    • 2021-10-29
    160 min

    [WAAA-117]Sorry To Keep You! Release of Black World Fuck Megaton Climax of Incontinence and Creampies in Unmatched Big Dick Large Marathon Orgy Kana Yume

  • kana yui censoredcreampiesquirtingWAAAones factorywanzWAAA-117WAAA117waaa00117
    • 2021-11-09
    51 min

    H4610 ki211109 Yukari Nishimaki 28years old

  • amateur uncensoredh4610
    • 2021-11-19
    65 min

    OREX-318 Sakura-san 2 (Tsuji Sakura)

  • amateur censoredcreampieamateurorexorex-318orex318orex-318
    • 2021-12-21
    99 min

    300MAAN-730 [Over 300 Experienced People! Numb To The Chin Blame Tech Of A Shaved Gal] Former Yang Gal In Special Attack Clothes Appeared! ？？ "Sex Is A Sport ♪" A Local Man Is A Super Spear Man Who Devoured Her And Her AV Actor Is Also Tajita

  • amateur censoredcreampieamateurmaanmaan-730maan730300maan-730
    • 2021-12-24
    130 min

    [PED-016]What Happened In The 7 Hours We Were Together？ 10 Rounds Of Fucking Starring Hana Himesaki

  • himesaki hana censoredbig titssingle workPEDdream ticketichinose kurumiPED-016PED01624ped00016
    • 2021-12-27
    59 min

    [ETQR-329][Daydream POV] The Tempting SEX Of A Slutty Beautiful Girl In Loose Socks - MAO

  • censoredcreampieuniformETQRerotic timeETQR-329ETQR329etqr00329
    • 2021-12-30
    21 min

    [HEYZO-2686]Akari Asagiri Erotic Massage for Akari

  • akari asagiri uncensoredcumshotheyzo
    • 2022-01-07
    150 min

    [SSIS-287]Drool, The Effects Of A Few Sips, Her Face During Sex, And Peeing Released All At Once. Yua Mikami Flies Indecently.

  • yua mikami censoredbig titssquirtingSSISs1 no 1 stylemon cSSIS-287SSIS287ssis00287
    • 2022-01-11
    66 min

    FC2PPV 2585015 [Limited] Idol-Class City Hall Staff’s Treasured Video Released.

  • amateur uncensoredfc2
    • 2022-01-14
    141 min

    [JUFE-360]Bursting Tits Wife Fucked In Neighbor"s Trash Room Impregnation Repeatedly Ejaculated By Dirty Middle-aged Man Momozono Rena

  • reina taoyuan censoredcreampiebig titsJUFEfitchJUFE-360JUFE360jufe00360
    • 2022-02-19
    239 min

    [OKAX-823]Small-Bodied Punitan"s Embarrassing Sex. 12 Bouncy Girls, 4 Hours.

  • censoredcreampieblowjobOKAXk m produceokazuOKAX-823OKAX823okax00823



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download