saki ninomiya




FC2AVSAMIDEMIAASQTEMEYDSPRDSTARSNGODSHKDMVSDHDKAJUFEAUKGHMNSSISONEZNNPJJULWANZCESD

2020-12-04
38 min

359TYVM-110 Instagrammer wife demon piss cum shot sex! !!

  • amateur censoredcreampiemarried womantyvmtyvm-110tyvm110359tyvm-110
    • 2020-12-05
    80 min

    300NTK-481 G-Cup Gal Soft Investor Saffle! !! The advent of a beautiful woman with a strong taste! !! Taking advantage of the body, the rainbow and the tide have fallen to the love hotel with Y-shaped balance fingering squirting! ？？ Even stocks are 1

  • ggal censoredcreampiebig titsntkntk-481ntk481300ntk-481
    • 2020-12-07
    53 min

    FC2PPV 1594592 [Personal shooting] [No] First shot Gachinko compensated dating girl! The third! Challenge with a wig for NG! 153cm small ass B cup slender Momo-chan with review benefits, high-quality ZIP, blowjob and masturbation (49 minutes)

  • amateur uncensoredfc2
    • 2020-12-22
    61 min

    Caribbeancom 122220-001 Jeans Beauty Vol.29 Non Suzumiya

  • non suzumiya uncensoredcreampiecaribbeancom
    • 2020-12-25
    90 min

    [DHT-237]CAR SEX DRIVE CHAPTER 2 - Yukari Mido, 39 Years Old

  • censoredamateurmature womanDHThot entertainmentshungoDHT-237DHT23759dht00237
    • 2020-12-31
    121 min

    [NDRA-083]My Wife Became A Whore For My Neighbor 32 Ayumi Kimito

  • kimi and ayumi censoredmature womansingle workNDRAjet eizomanji groupNDRA-083NDRA083ndra00083
    • 2021-01-07
    118 min

    [AKDL-076](Amateur + Big Tits) Young Dental Assistant With Superbly Sensitive H-Cup Tits - Touching Her Nipples Makes Her Cum Hard Ayase

  • censoredbig titsamateurAKDLaquinoristickaknrAKDL-076AKDL0761akdl00076
    • 2021-01-08
    64 min

    SIRO-4347 [First shot] [Neat wife’s unfaithful cum] [Lady’s beautiful breasts] The first unfaithful SEX of a neat and clean woman with a child in the 13th year of marriage. She is pierced by a meat stick other than her husband for the first

  • amateur censoredbig titsmarried womansirosiro-4347siro4347siro-4347
    • 2021-01-09
    40 min

    275OCHA-079 Arisa

  • amateur censoredschoolgirlamateurochaocha-079ocha079275ocha-079
    • 2021-01-26
    99 min

    FC2PPV 1660324 [No / Amateur individual shooting] Ikareta bottomless sexual desire like an erotic manga Creampie sex with a wife and outdoor exposure with public exposure! This is a genuine nympho, withdrawal symptom that convulsions when too lustful

  • amateur uncensoredfc2
    • 2021-02-02
    49 min

    H4610 ki210202 Emi Hasegawa 21years old

  • amateur uncensoredh4610
    • 2021-02-05
    482 min

    [PPT-105]Minamo Nagase 8-Hour BEST PRESTIGE PREMIUM TREASURE Vol. 03 - All 6 Titles By "Minamo Nagase" Permanently Preserved In This Collector's Edition!

  • minase nagase censoredcreampiebig titsPPTprestigeprestige premium treasurePPT-105PPT105118ppt00105
    • 2021-02-06
    57 min

    Pacopacomama 020621_431 Sex at front door 26 – Shapely Figure Stands Out Sexy Lingerie Sumire Maeda

  • amateur uncensoredpacopacomama
    • 2021-02-06
    102 min

    FC2PPV 1673452 [Black 3P x NTR x personal shooting] Deviation value 70! Black Mara Completely Fallen Kei ○ Girls! The strongest black tag in front of her boyfriend is a 21-year-old talented JD with a black thick 3P decamara rarely inserted and vagina

  • amateur uncensoredfc2
    • 2021-02-11
    301 min

    [MIST-327]Bubble Massage With Cowgirl Sex As A Bonus - 300 Minutes

  • hasumi claire hosaka eri censoredcreampiebig titsMISTmr michiruMIST-327MIST3271mist00327
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-11
    110 min

    [FSDSS-166]My New Wife - Sora Fucks Like A Slut, Sora Amakawa

  • tenkawa sora censoredbig titssingle workFSDSSfalenoyamaguchi memberfaleno starFSDSS-166FSDSS1661fsdss00166
    • 2021-02-12
    148 min

    [DASD-815]A Year Of Delinquency - Rui Nanase

  • nanase rui censoredcreampiebeautiful girlDASDdasnao masakiDASD-815DASD815dasd00815
    • 2021-02-16
    63 min

    [tkwa-156]まいな

  • amateur censoredbig titsschoolgirltkwatkwa-156tkwa156tkwa-156
    • 2021-03-02
    42 min

    S-Cute tat_073 Indecent and cute Gonzo H of a ponytail girl / Sara

  • sara censoredamateurtattat-073tat073tat-073
    • 2021-03-04
    65 min

    336KNB-144 Please hit your ass a lot! De M fair-skinned wife appears in AV because of sexlessness with her husband! !! Massive vaginal cum shot with raw insertion from slimy tech show with lotion play! !! !! I will take a gonzo with this married woma

  • amateur censoredcreampiemarried womanknbknb-144knb144336knb-144
    • 2021-03-06
    239 min

    [HUNTA-960]"Please Stop! I'm Cumming So Much I Think I'm Going To Lose My Mind!" My Little Stepsister Was Thrusting Out Her Tight, Godly Ass, And I Could No Longer Resist ... So I Entered Her Raw, From Behind! And Then I Pumped Her Wi

  • censoredcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-960HUNTA960hunta00960
    • 2021-03-10
    40 min

    FC2PPV 1719889 No37 A shy girl who is shy. I took a hidden shot of the lewd nature.

  • amateur uncensoredfc2
    • 2021-03-14
    116 min

    421OCN-020 Yukki

  • amateur censoredcreampieamateurocnocn-020ocn020421ocn-020
    • 2021-04-04
    59 min

    300NTK-547 Echikawa Minimum G Cup Lori Beautiful Girl! !! "Small girl too erotic theory" proved safely! !! Chibikawa busty beautiful girl’s sexual festival that immediately accelerates and lusts after entering the room! !! With mouth, ha

  • amateur censoredcreampiebig titsntkntk-547ntk547300ntk-547
    • 2021-04-10
    54 min

    FC2PPV 1763406 [Creampie in gravure] [Leaked] Freshly married I cup huge breasts gravure Erotic female warrior costume gonzo, cum shot video leaked idol (leaked gonzo data)

  • amateur uncensoredfc2
    • 2021-04-11
    47 min

    FC2PPV 1764451 [First shot] That girl who has a cute feeling of being a little stretched was the first experience of vaginal cum shot ♥♥

  • amateur uncensoredfc2
    • 2021-04-15
    120 min

    [KSBJ-131]A Newly-married Stepniece Tempted By Her Stepuncle - Sachiko

  • sachiko censoredcreampiebig titsKSBJksb kikaku emmanuellebito sakuraKSBJ-131KSBJ131ksbj00131
    • 2021-04-30
    480 min

    [326SOH-001]【神BEST】水着ナンパ×巨乳・爆乳美女！真夏のビーチやプールでGETした至極の神乳素人20名

  • amateur censoredcreampiebig titssohsoh-001soh001326soh-001
    • 2021-05-02
    240 min

    [MLSM-044]Top Class Beautiful Cougars Best Asahi Mizuno 4 Hours Slender Big Titty Madonna

  • mizuno chaoyang censoredcreampiebig titsMLSMmellow moonMLSM-044MLSM044mlsm00044
    • 2021-05-02
    23 min

    FC2PPV 1799148 GW limited [appearance] Prefectural general course ③ Karate club beautiful girl. Pre-graduation treasured video. Secretly vaginal cum shot

  • amateur uncensoredfc2
    • 2021-05-06
    297 min

    [AKDL-108]An Amateur Babe I Met On Thursday 3 (Faces Revealed / Sex During Office Hours / Pussy Stains / POV / She Has A Boyfriend / Superior Big Tits)

  • censoredbig titsamateurAKDLaquinoriaquinoriaknrAKDL-108AKDL1081akdl00108
    • 2021-06-19
    148 min

    [JUL-626]I Heard My Wife's Voice Over The Phone When Talking To My Friend... Marina Saito

  • marina saito censoredmature womansingle workJULmadonnaunicorn fukudaJUL-626JUL626jul00626
    • 2021-06-24
    73 min

    200GANA-2515 Seriously Nampa, first shot. 1652 Bring the gal JD on the way back from the hairdressing shop to the hotel as an interview! Pretending to be drunk and trying to do something sexually harassing …？ The fair-skinned body and smooth but

  • amateur censoredsquirtingamateurganagana-2515gana2515200gana-2515
    • 2021-06-24
    150 min

    [MOND-216]I Want My Boss Miki Yoshii

  • good miki ryoko izawa miki yoshii censoredsingle workMONDtakara eizoshun bisakudaiichi housouMOND-216MOND21618mond00216
    • 2021-07-07
    33 min

    FC2PPV 1909855 Deleted at 14. [No] A beautiful hairless beauty. After she opened her business, she called to karaoke and forcibly committed it on the spot and made vaginal cum shot in the female hole.

  • amateur uncensoredfc2
    • 2021-07-10
    68 min

    SIRO-4592 [First shot] [Goddess-class beautiful girl JD] [Goddess-class god milk service] Active JD with a beautiful face that is far from the Japanese participates in the war. She fascinates the god fucking enough to fill a big cock, and she stares

  • amateur censoredbig titsamateursirosiro-4592siro4592siro-4592
    • 2021-07-31
    132 min

    FC2PPV 1948352 I secretly removed the rubber on the way to a loli bristle slender with one experienced person and made a vaginal cum shot, a stunned expression. & 19-year-old G cup fair-skinned beautiful breasts JD is thrust at her first raw cock

  • amateur uncensoredfc2
    • 2021-08-06
    172 min

    [BNST-033]This Girl Is A Wolf In Sheep"s Clothing, Nozomi

  • censoredblowjobbeautiful girlBNSTteacher delusion groupthere is alsoBNST-033BNST033bnst00033
    • 2021-08-11
    46 min

    H4610 ki210815 Madoka Kanbe 21years Old

  • amateur uncensoredh4610
    • 2021-08-13
    119 min

    [PPPD-951]We"ll Send You The Big Tits Ex Sports Commentator Bitch That Gives You Titty Fuck Blowjobs Instantly. Reona Tomiyasu

  • takehiro tomiyasu censoredcreampiebig titsPPPDoppaiPPPD-951PPPD951pppd00951
    • 2021-08-21
    240 min

    [GIGL-656]From-Above Footage: Cheeky Married Woman Coming From The Piston Action Of A Weakling

  • censoredblowjobGIGLgigolo jigorogigoloGIGL-656GIGL656gigl00656
    • 2021-08-21
    239 min

    [NANX-235]A Pair Of Older Women On A Night Out Over The Weekend At A Bar. Lonely Living Without Boyfriends, They Pick Up Guys In The Bar And No Matter What You Say You Cannot Escape Their Grasp 2!!

  • censoredbig titsmature womanNANXk m producenanpa heavenNANX-235NANX235nanx00235
    • 2021-08-24
    60 min

    10musume 082421_01 Slimy Big Breasts In Competitive Swimsuit Rino Kudo

  • amateur uncensored10musume
    • 2021-08-26
    133 min

    [NTRD-094]Cuckolders: What, With My Junior... Mayu Suzuki

  • suzuki mayu censoredsingle workNTRDtakara eizoutakara hiroshine tou kaiNTRD-094NTRD09418ntrd00094
    • 2021-08-27
    124 min

    [DFE-056]My Stepdaughter Will Do It. Marina Saito

  • marina saito censoredcreampieuniformDFEwaap entertainmentsasanishikifearlessDFE-056DFE0562dfe00056
    • 2021-09-07
    474 min

    [KTRA-331]I Will Devote Myself To My Older Browther! My Younger Sister"s Slender Flat Chested Body. 8 Hour 4 Disc Set BOX

  • ok suzu yamai censoredcreampieKTRAke toraibuk tribeKTRA-331KTRA331h-094ktra00331
    • 2021-09-18
    120 min

    [C-2667]Wife"s Friend Ended Up Staying At Our Place, It Seemed Natural For Me To Move On "Married Woman Sonoko (Stage Name) 30 Years Old"

  • censoredmature womanCgo go zutakahashi kouichigogos coreC-2667C2667



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download