pretty




FC2PREDMARASQTECHRVVEMASPRDNACRHDKABLKAMBIJULJUFEKSBJHODVAUKGPPPDDTTNATRAWDFSDSS

2020-12-31
41 min

FC2PPV 1627201 [Personal shooting] A married woman of a life insurance lady who burns in a bad act! Cheating wife who shakes a beautiful naked body and faints in agony at the woman on top posture [Creampie]

  • amateur uncensoredfc2
    • 2020-12-31
    195 min

    [NKKD-188]Cheating Sex With A Married Woman In A Public Washroom While She's Out For A Drive With Her Family! 4 Sex In A Stall

  • censoredmature womanNKKDjet eizomanji groupNKKD-188NKKD188nkkd00188
    • 2021-01-14
    53 min

    230OREC-672 Nozomi sensei

  • amateur censoredcreampieamateurorecorec-672orec672orec-672
    • 2021-01-15
    97 min

    [SALO-033]Breaking In At The Office Arisa Hanyu

  • arisa hanyu arisu hanyu censoredsingle workSALOk m producesalomeSALO-033SALO03384salo00033
    • 2021-01-15
    120 min

    [NATR-649]She Loves Sex! My Brother`s Too Naughty Wife!! Yume Izumi

  • yume izumi censoredcreampiebig titsNATRnadeshikobito sakuraNATR-649NATR649h-067natr00649
    • 2021-01-22
    130 min

    [HZGD-177]"Sorry, Darling..." Bred By Her Father-In-Law On Her Ovulation Day - Wife Made To Take A Creampie Hana Haruna

  • haruna hana censoredcreampiebig titsHZGDmarried woman flower garden theaterhirokoji osakiimage married woman flower garden theatHZGD-177HZGD177h-1100hzgd00177
    • 2021-02-05
    97 min

    415LAS-035 Wannyan

  • amateur censoredcreampiesquirtinglaslas-035las035415las-035
    • 2021-02-10
    53 min

    [ykmc-049]七海(19)

  • amateur censoredcreampiebig titsykmcykmc-049ykmc049ykmc-049
    • 2021-02-16
    57 min

    444KING-028 Nono

  • amateur censoredcreampiebig titskingking-028king028444king-028
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-26
    118 min

    [GNAX-046]Nympho Wives Screaming In Pleasure In The Middle Of The Day - Filthy Fertility Massage They Can't Tell Their Husbands About - Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsGNAXnagiranagira kenzoGNAX-046GNAX046h-1345gnax00046
    • 2021-03-04
    56 min

    C0930 ki210304 Kazumi Okamoto 26years old

  • amateur uncensoredc0930
    • 2021-03-06
    122 min

    [NKKD-197]Housewife Sweetly Wrapping A Younger Horny Guy Up In Her Freshly Worn Underwear And Milking Him Dry - Ka Ayano Fuji

  • ayano kato censoredbig titsmature womanNKKDjet eizomanji groupNKKD-197NKKD197nkkd00197
    • 2021-03-17
    76 min

    376H-621 Bondage Innocent Uniform Girls ●● Squid With SEX! ＃ Narumi ＃ 18 years old

  • amateur censoredcreampieuniformhh-621h621376h-621
    • 2021-03-20
    45 min

    FC2PPV 1735003 Youtuber full power Manki ◯ -san collaboration project, the second 3P project of those two beautiful women individual shooting, individual shooting completely original 82nd person, vaginal cum shot

  • amateur uncensoredfc2
    • 2021-03-22
    96 min

    240TOKYO-419 Saori

  • amateur censoredbig titsamateurtokyotokyo-419tokyo419240tokyo-419
    • 2021-03-26
    70 min

    329EXMU-062 Satomi-chan

  • amateur censoredcreampieschoolgirlexmuexmu-062exmu062329exmu-062
    • 2021-04-08
    127 min

    [MEKO-208]New "Rental MILF" Service 11 - They Say You Can Give Them A Creampie So We Tried Asking For Even More Extreme Services

  • censoredcreampieamateurMEKOmature woman laboMEKO-208MEKO208h-1160meko00208
    • 2021-04-12
    240 min

    [MQSM-004]The Cruel And Shameful Orgasms Of A Young Maiden - The Legendary Orgasm Files - Young Barely Legal Babes Are Pumping Out Dangerous Fragrances From Their Young, Budding Vaginas

  • censoredMQSMmercuryecstasyMQSM-004MQSM004h-1133mqsm00004
    • 2021-04-15
    245 min

    [BIJC-017]Hot Witch COLLECTION vol. 16

  • honoka takikawa manami oura censoredcreampiebig titsBIJCbeautiful witch emanuelbeautiful witchBIJC-017BIJC017bijc00017
    • 2021-04-17
    66 min

    FC2PPV 1773439 [Limited Premier] 3 former popular idols-Caution for immediate deletion-

  • amateur uncensoredfc2
    • 2021-04-20
    97 min

    [NUBI-050](The Theater Of Shame) These Innocent Girls Are Getting Shamed And Getting Their Nipples Erect With Excitement! And When They Get Their Pussies Teased, They Start To Leak With Shameful Pussy Juice! They'll Fall Madly In Love With You Wh

  • censoredcreampieamateurNUBIkalimantannubiaNUBI-050NUBI050h-1112nubi00050
    • 2021-04-27
    137 min

    [KNMB-012]Totally Raw [email protected] #A Gal Who Cums Too Much #Blonde And Cute #A Nice Personality #Her First Creampie On Camera #Check Out Her Fuck Face (LOL) #Successful Rough-Riding Creampie Sex #Her First Raw Pay-For-Play Fuck #Simple De

  • riria hido censoredcreampiebeautiful girlKNMBfirst star100 raw styleKNMB-012KNMB012h-491knmb00012
    • 2021-05-16
    70 min

    413INST-122 [Major company model] Leaked ● Hard raw SEX at a secret cosplay photo session A narrow pussy is opened with a thick cock and acme died in a few minutes ● ● Seeding (leaked Gonzo data)

  • amateur censoredcreampiebig titsinstinst-122inst122413inst-122
    • 2021-05-18
    51 min

    H4610 ki210518 Rumi Iwashita 20years old

  • amateur uncensoredh4610
    • 2021-05-22
    121 min

    [RYZR-004]Mouth-Watering Half Japanese Girl With A Huge Ass And Huge Tits 2 Yuki

  • censoredcreampiebig titsRYZRtoyohikotoyohikotoyohiko kikakuRYZR-004RYZR004ryzr00004
    • 2021-05-25
    55 min

    FC2PPV 1835787 Kimi, it’s almost like letting me be youth like this 2 ♪ Rokuki Layer-san Nakashi Nakashibe Echiechi Unipaisen Part2

  • amateur uncensoredfc2
    • 2021-05-29
    133 min

    [JJCC-002]Cheating Wife Who Wants Sperm

  • censoredcreampiebig titsJJCCjukujo japanJJCC-002JJCC002jjcc00002
    • 2021-06-11
    120 min

    [EBOD-830]24 Hours Cooped Up With A Hot Young Shut-In Nerd Girl With Huge Tits For Aphrodisiac-Addled Creampie Sex Nemu Kisaki

  • kisaki nemu censoredbig titssquirtingEBODe bodymichiru arashiyamaEBOD-830EBOD830ebod00830
    • 2021-06-11
    126 min

    [BANK-042]A Coed Gal Hot Spring Resort Good Time A Super Beautiful Gal! These Aren't Fake Titties, These Are The Real Thing, Shaped Like Bowls, And Attached To A Genuinely Slutty And Horny Gal Chisato Morisaki

  • tomomi morisaki censoredanalcreampieBANKpussy banktake chanBANK-042BANK042h-1495bank00042
    • 2021-06-11
    120 min

    [MUDR-152]Ever Since That Day... Beautiful Y********l In A School Uniform Is Tied Up, Trained, And Filled With Cum Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiebdsmMUDRinnocentMUDR-152MUDR152mudr00152
    • 2021-06-15
    64 min

    FC2PPV 1869705 [No] [High-quality review privilege] Until the essence is exhausted ♡ One-on-one 1-hour endurance vaginal cum shot SEX game‼ Break through the limit of 6 consecutive shots! ‼ ‼

  • amateur uncensoredfc2
    • 2021-07-02
    157 min

    [NKKD-217]My Wife (30) Was Fucked By Her Virgin Coworker (20)... I'm So Angry I'm Selling The Film As Porn (Virgin Hunting Series)

  • censoredNKKDjet eizoNKKD-217NKKD217nkkd00217
    • 2021-07-04
    57 min

    413INST-136 [Unprecedented 6P outflow! ] Big areola for big breasts and beautiful breasts! Bitch 3 Beauty vs Big Cock Corps Creampie! Squirting! Continuous Acme Sake Pond Meat Forest Hyper Raw Saddle Orgy

  • amateur censoredcreampiebig titsinstinst-136inst136413inst-136
    • 2021-07-06
    82 min

    493NAEN-078 Yen! ？？ Systemic genitals! ？？ Super Sensitive Bitch Girls ○ Ryoka Kurumi Commits Raw High Speed Piston All Night

  • amateur censoredamateurbeautiful girlnaennaen-078naen078493naen-078
    • 2021-07-09
    20 min

    FC2PPV 1913436 [Tokyo beauty’s word blame handjob] Ejaculation with the intercrural sex option of Geki Kawa rookie Eri! I really want to have sex [High-class onakura hidden shooting]

  • amateur uncensoredfc2
    • 2021-07-22
    48 min

    C0930 ki210722 Maki Shikano 49years old

  • amateur uncensoredc0930
    • 2021-08-10
    61 min

    230OREC-850 Kozue

  • amateur censoredcreampieamateurorecorec-850orec850230orec-850
    • 2021-09-04
    51 min

    [DANDAN-014]A Seductive Wife!？ She Has A Sexy White Dress On Showing Off Her Ass, Leading To A Mistaken Quickie! What Should Be Anger Leads To A Desire To Get Her Pussy Fucked And Then Confess Everything! Wife With A Perfect Ass, Mai-san (34 Years Ol

  • censoredmarried womanblowjobDANDANdandyDANDAN-014DANDAN0141dandan00014
    • 2021-09-10
    118 min

    [IPX-729]To Whom It May Concern: "I Slept With My Brother"s Wife." My Sister-In-Law Is A Secret Dick-Sucking Slut. She Lives Out In The Country By The Sea. While My Brother Was Away, I Banged Her. Nanami Misaki

  • nanami misaki censoredblowjobsingle workIPXidea pocketzampadishIPX-729IPX729ipx00729
    • 2021-09-24
    78 min

    520SSK-028 [Sex Appealing Strongest Beauty Who Seduces Infinitely] Everything From Looks To Voice Is Seduced By A Fascinating Beauty And A Dirty Date For The Rest Of Her Life! !! In The Car On The Move, I’m Stimulating Po, And I’m Going To

  • amateur censoredcreampiebig titssskssk-028ssk028520ssk-028
    • 2021-09-24
    74 min

    300NTK-637 [Hakata G Milk] [High Erotic Potential] [Glamorous Nn2 Squeezing] Echiechi’s Blessing Revechi Body Beauty Advent! !! Sweet! !! The Sexual Offense That Attacks With The Extremely Sweet Echi Style Rich Technique Is Fierce! !! The Ultima

  • amateur censoredcreampiebig titsntkntk-637ntk637300ntk-637
    • 2021-10-02
    227 min

    [SORA-337]A Cum Swallowing Date With A Blowjob Buddy A Meaty And Voluptuous Office Lady Is Seriously Cumming And Pissing Herself Silly! She"s And Exhibitionist, Opening The Golden Shower Floodgates While D***king Down 6 Cum Shots!! Kurumi Tamaki

  • tamaki walnut censoredblowjobsingle workSORAyama to soradenchuuSORA-337SORA337sora00337
    • 2021-10-08
    139 min

    [YMDS-052]Partying At Home Instead Of Going Out, Leading To Passionate, Deeply Intimate French Kissing And Sex. The Day Iroha Minami Became My Girlfriend.

  • minami iroha censoredcreampieblowjobYMDSmomotarou eizou shuppanishikiribashi hakasejaku momoYMDS-052YMDS052ymds00052
    • 2021-10-08
    154 min

    [IPX-747]Coercion From An Intense Older Guy That Makes Me Take His Dirty Dick Every Single Day. Late-night Nurse Call That Signals To A Sexual Service. Nanami Misaki

  • nanami misaki censoredcreampieblowjobIPXidea pocketmaeda bungoutissueIPX-747IPX747ipx00747
    • 2021-10-08
    37 min

    [tyvm-198]ゆかり(38)

  • amateur censoredcreampieamateurtyvmtyvm-198tyvm198tyvm-198
    • 2021-10-22
    29 min

    FC2PPV 2363799 [Leakage] * Sold For A Limited Time * S-Class Mammoth Company, Beauty Receptionist, Counter Breakout, Blow Job Outflow In A Private Room As A Crackdown [Handling Precautions]

  • amateur uncensoredfc2
    • 2021-11-02
    98 min

    261ARA-514 [God Beauty] [Halloween] Non-Chan Is Here! I Can’t Stand It Just By Looking At My AV-Loving Daughter ♪ I Want Muddy Sperm Instead Of Sweets At Halloween W Let’s Paco At Halloween Party Night ♪ [Super Beauty ★ Big Tits] [Prepuri ★

  • amateur censoredbig titssquirtingaraara-514ara514261ara-514



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download