nazuno nonohara




FC2VENUAPODNNPJDTTSSNIAVSASQTECAWDMILKGVHNATRDASDAMBIHUNTBROYDJULBBANHNDHDKASTARS

2020-12-27
63 min

H0930 ki201229 Harumi Nakajima 46years old

  • amateur uncensoredh0930
    • 2021-01-01
    142 min

    [KTB-038]For Use At The Office - Seducing 26-Year-Old Married Office Worker Kanade - Bukkake! The Office Girls In Suits Club 17 Kanade Tsuchiya

  • kana tsuchiya censoredcreampiesingle workKTBkahanshin tigers mousouzokukahanshin tigersKTB-038KTB038ktb00038
    • 2021-01-10
    149 min

    [GENT-154]It's Incredible...! This Desperate MILF Has Agreed To Become My Creampie Cum Dumpster! (Swooning With Ecstasy - Two MILFs Impregnated Right On Camera)

  • censoredcreampieGENTgentle man mousouzokugentlemangentleman mousouzokuGENT-154GENT154gent00154
    • 2021-01-16
    56 min

    H0930 tk0027 Izumi Tobe 32years old

  • amateur uncensoredh0930
    • 2021-01-21
    61 min

    [REBD-525]Marin 2 Basking In The Summer Sun - Marin Hinata

  • marin hinata censoredsingle workREBDrebeccazaku araiREBD-525REBD525h-346rebd00525
    • 2021-01-24
    129 min

    [AVSA-153]Breaking In A Hot Cross-Dresser - This Hot Slut Sub Can Only Cum From Anal Orgasms, And The Back Door Is Open Naru Tsukishima

  • tsukishima censoredanalbdsmAVSAavs collector sluc assavscollector sAVSA-153AVSA153avsa00153
    • 2021-01-27
    241 min

    [FSPT-008]They are loose, but calm you down. Countryside Girl Collection

  • censoredbig titssquirtingFSPTfirst starpeachteenFSPT-008FSPT008h-491fspt00008
    • 2021-01-27
    18 min

    FC2PPV 1661288 Until 30th 480pt → 300pt [Personal shooting] Secret meeting with a slender young wife. I connected it with a chain and blamed Denma and then squirted.

  • amateur uncensoredfc2
    • 2021-01-31
    52 min

    [orex-240]美緒

  • amateur censoredcreampiesquirtingorexorex-240orex240orex-240
    • 2021-02-08
    57 min

    [ETQR-192](Daydream POV) Raw Creampie Sex With A Barely Legal Beautiful Girl In A School Sailor Uniform. Kanna 02

  • censoredcreampieuniformETQRerotic timeETQR-192ETQR192h-1186etqr00192
    • 2021-02-11
    128 min

    [MEKO-204]All New "The Old Lady Rental" Service 08 I Heard About This Housecleaning Service That Would Let You Have Creampie Sex, So I Decided To Make Even More Extreme Demands

  • censoredcreampieamateurMEKOmature woman laboMEKO-204MEKO204h-1160meko00204
    • 2021-02-12
    196 min

    [ABW-054]Mine And Remu's Fantasy World Sex Life ACT. 07 - Breaking Through All Erotic Borders With The Strongest Sexy Armor!!! Remu Suzumori

  • suzumori remu censoredbig titssquirtingABWprestigemichiru sanabsolutely wonderfulABW-054ABW054118abw00054
    • 2021-02-16
    51 min

    C0930 ki210216 Kie Nishizaki 44years old

  • amateur uncensoredc0930
    • 2021-02-28
    109 min

    [RD-1041]Hot Older Wife Impregnated By Father In Law On Purpose Fifty Something Married Woman Gets Seduced By The Neighbor On The Same Day She Moves In

  • namiki touko ryo fukutomi censoredmarried womanblowjobRDathena videomurayamaathenaRD-1041RD1041149rd01041
    • 2021-03-16
    46 min

    FC2PPV 1729348 [Ona prohibited series! ] Creampie SEX from 3 shots without a blow job ♥ Shooting that was forbidden for a week, it should be a promise only for a blow job … Creampie www * High quality version & review benefits included [Perso

  • amateur uncensoredfc2
    • 2021-03-18
    122 min

    [C-2624]Girl Trip 019

  • censoredlesbianCgogoscore gogo sC-2624C2624
    • 2021-03-20
    120 min

    [NXG-361]Blushing Amateur Wife Can't Believe She's So Wet And Horny After Taking A Shameful High Paying Job...

  • censoredamateurcosplayNXGstar paradisenext groupNXG-361NXG361h-254nxg00361
    • 2021-03-25
    93 min

    [HONE-259]I Was Unable To Resist The Meaty Body Of My New Stepmom, So I Creampie Fucked Her Reiko Kobayakawa

  • kobayakawa reiko censoredcreampiemature womanHONEcenter villageminatoyahanazono center villageHONE-259HONE259h-086hone00259
    • 2021-04-14
    102 min

    428SUKE-068 [Whole body binkan sickness big breasts] Rent a charger and surfer girls and Pakopako SP! !! Buy a box of sake! Go to the hotel drink! !! The best big tits of instant sickness and immediate squirrel! No matter where you are on the floor,

  • amateur censoredcreampiebig titssukesuke-068suke068428suke-068
    • 2021-04-14
    211 min

    [HUNTA-997]The Girl I Had A Crush On In School Has Transformed Into A Wild Slut？! We Met Again At Our Class Reunion And After A Little Liquor The Hottest Girl School Came Back To My Place. Only Now She's Even Hotter...

  • censoredblowjobHUNTAhunterspace nyanjirohhh groupHUNTA-997HUNTA997hunta00997
    • 2021-04-16
    96 min

    300NTK-553 Bottomless libido! !! A beautiful wife who screamed acme in the center of Shibuya who devoured pleasure by stacking the unspecified number of unfaithfulness of the extremely horny body and stacking the horny butt of the finest F milk on th

  • amateur censoredcreampiebig titsntkntk-553ntk553300ntk-553
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-07
    160 min

    [MIRD-212]Holy Water Harem - Four Beautiful Girls Piss To Make You Cum Buckets! Mikako Abe Noa Eikawa Rei Kuruki Mitsuki Nagisa

  • abe mikako sakaegawa noa censoredsquirtingbeautiful girlMIRDmoodyznao masakimoodyz realMIRD-212MIRD212mird00212
    • 2021-05-17
    50 min

    318LADY-369 Yui

  • amateur censoredbig titsamateurladylady-369lady369318lady-369
    • 2021-06-11
    120 min

    [MEYD-681]If You Cannot Pay Your Rent, Should We Ask Your Wife To Pay With Her Body Instead？ Haha Kanna Hirai

  • shiori hirai censoredsingle workdramaMEYDtameike gororyo inugamiMEYD-681MEYD681meyd00681
    • 2021-06-15
    40 min

    [NYH-135]On A Crowded Bus, I Get Close To A Married Woman With Big Tits On Her Way Home From Shopping And Put My Hard Cock Up Her Miniskirt To Arouse Her And Fuck Her On The Spot / Miss Yuika Yuika Takashima

  • yuka takashima censoredbig titsmarried womanNYHdirectorsdirectorsnyan nyan houseNYH-135NYH1351nyh00135
    • 2021-06-25
    145 min

    [MIDE-943]Fucking A Body Exploding With Sensitivity All Day Long Non-Stop Unlimited Orgasms Aphrodisiacs Squirting Ultimate Climax Shoko Takahashi

  • shoko takahashi censoredbig titssquirtingMIDEmoodyzdragon nishikawamoodyz divaMIDE-943MIDE943mide00943
    • 2021-07-02
    125 min

    [ARM-994]Erotic Ass: Anal Showing Cowgirl

  • ayaka muto hanaoto urara censoredanalslutARMaroma planningmania satoshiaromaARM-994ARM994arm00994
    • 2021-07-11
    92 min

    345SIMM-652 Innocent J ○ is alive in a row! J ○, who seems to be anywhere at first glance, is the most realistic and excited! The shy Aina-chan’s erogenous zone No. 1 is in the back of the vagina regardless of appearance! ？？ For Aina who likes t

  • amateur censoredcreampieuniformsimmsimm-652simm652345simm-652
    • 2021-07-14
    186 min

    [HUNTB-052]I Was A Runaway, And This Kindly Slutty Elder Sister Type Took Me In, And We Started Living Together In A Dream-Cum-True Quickie Sex Life! Am I Living The Life Of A Fuck Fest Cock!？ I Was Going Through Various Problems At Home, So I Decide

  • censoredcreampieHUNTBhunterkawajirihhh groupHUNTB-052HUNTB052huntb00052
    • 2021-07-18
    122 min

    [GMEM-037]A Live-in Lover Who Awakens To Her Lewdness And Turns Into A Masochistic, Whip-loving Wife - Arisu Otome

  • otsu alice censoredbig titsdeepthroatGMEMavs collector sbuddha davscollector s goldGMEM-037GMEM037gmem00037
    • 2021-07-22
    149 min

    [WAAA-086]Crazy Lewd Sex with You With Lust Aphrodisiac!! Being Eaten By A Pleasure-crazy Lover Craving For Stimulation ... Tsubomi

  • bud censoredcreampieslutWAAAwanz factorywanzWAAA-086WAAA086waaa00086
    • 2021-07-27
    105 min

    SHPV-002 Nacchan

  • amateur censoredamateurbeautiful girlshpvshpv-002shpv002shpv-002
    • 2021-07-30
    85 min

    483SGK-035 "Unrivaled Ji ● Po Love" "Innocent Girl In The Country" "Gutchori Wet Wet Constitution" "Ecchi For The First Time In A Year" "Super Do M Ichayo Climax" A Country Girl Working At A Factory From T

  • amateur censoredamateursgksgk-035sgk035483sgk-035
    • 2021-08-05
    70 min

    326MASS-005 Echiech Momojiri College Student / Ria-Chan (19) Reasonly Jumps And Climax Ascension With The Power Of Aphrodisiac And Sexual Feeling Oil Massage! !! I Am Stunned By The Waves Of Pleasure That Rush In Many Times! !! A Large Amount Of Vagi

  • amateur censoredcreampieamateurmassmass-005mass005326mass-005
    • 2021-08-13
    124 min

    [MVSD-474]I Ended Up Sharing A Room With Young Female Graduate With A Slim Waist NTR Special She Let Me Fuck And Come Inside Her Minami Hatsukawa

  • hatsukawa minami censoredcreampiebeautiful girlMVSDm s video groupms video groupMVSD-474MVSD474mvsd00474
    • 2021-08-14
    120 min

    [SCD-195]40 Year Old Stepmom Sluts It Up With Her Prized Huge Tits After Giving Me An Aphrodisiac, Nanao Nakano

  • nanao nakano censoredmature womanslutSCDrubytsuji koujisecret rubiSCD-195SCD195scd00195
    • 2021-09-05
    55 min

    233BAT-093 Mikako

  • amateur censoredcreampieamateurbatbat-093bat093233bat-093
    • 2021-09-11
    77 min

    200GANA-2555 Seriously Nampa, First Shot. 1687 Cute And Charming! I Have A Boyfriend And I’m Meeting With A Friend … A Lewd Girl Who Has Been Drunk By The Atmosphere And Has Sex! Enjoy The Cute Heavenly Use From The Beginning To The End, Wh

  • amateur censoredsquirtingamateurganagana-2555gana2555200gana-2555
    • 2021-09-15
    62 min

    444KING-048 Lala

  • amateur censoredcreampiesquirtingkingking-048king048444king-048
    • 2021-09-18
    66 min

    H4610 ki210919 Eri Tanba 22years Old

  • amateur uncensoredh4610
    • 2021-10-02
    101 min

    [SQTE-385]Will You Jerk Off Using Me？ -F Cup Hottie"s Slutty Desire- Sakura Tsuji

  • sakura tsuji censoredbig titsblowjobSQTEs cutes cute s cuteSQTE-385SQTE385sqte00385
    • 2021-10-29
    116 min

    [ATID-485]Female Detective Eri Takigawa Fell Into A BBP Big Black Penis

  • eri takikawa misato arisawa censoredsingle workATIDattackershaga eitarouin madATID-485ATID485atid00485
    • 2021-11-04
    67 min

    SIRO-4690 [First Shot] [Overflowing Eros] [Superb Beauty Naked Body] An Active Campaign Girl Wife With The Finest Physical Beauty Appears. If You Play With A Sensitive Body, You Will Further Increase The Leaking Eros And Get Drunk With The Pleasure O

  • amateur censoredbig titsmarried womansirosiro-4690siro4690siro-4690
    • 2021-11-08
    41 min

    362SCOH-056 [Creampie] Let A Carefully Selected Beautiful Girl Cosplay And Conceive My Child! [Eri ● Beth] Akari Niimura

  • amateur censoredcreampiebig titsscohscoh-056scoh056362scoh-056
    • 2021-11-14
    61 min

    [HEYZO-2656]Nami Minami Having Lovely Time With A Big Tits Amature Gril Vol.3

  • nami minami uncensoredcreampiehandjobheyzo
    • 2021-12-01
    69 min

    259LUXU-1512 Luxury TV 1490 "I Want To Blame The Actor", A Slender Beauty Appears To Make A Small But Bold Dream Come True! Show Off Nasty Tech While Shaking The Plump Beauty Big Tits, And Devour The Cock Violently At The Woman On Top Posture

  • amateur censoredbig titsamateurluxuluxu-1512luxu1512259luxu-1512
    • 2021-12-05
    65 min

    [HEYZO-2672]Miho Ohyama Having Lovely Time With A Big Tits Amature Gril Vol.4

  • miho ohyama uncensoredcreampieheyzo



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download