natsuki takeuchi




FC2NGODHODVHMNDASDONEZJULHZGDVEMAEBODBLKSSISPPPDMILKHNDAWDDASDAVSACHRVAMBIWANZ

2020-11-26
60 min

FC2PPV 1584745 ☆ Complete appearance ☆ Minimum legal Lori beauty busty beautiful girl and uniform costume SEX ♥ Excited raw vaginal cum shot with too sensitive erotic body ♪ [With benefits]

  • amateur uncensoredfc2
    • 2020-11-26
    61 min

    10musume 112620_01 A carnivorous girl wearing a see-through China dress and having rich sex Miyuki Takada

  • amateur uncensored10musume
    • 2020-11-28
    204 min

    [BDSR-436]Married Woman Real Adultery Leaked Love Hotel Voyeur: The Decisive Moment Of Corruption Completely Caught On Tape!

  • censoredcreampiebig titsBDSRbig morkalBDSR-436BDSR43657bdsr00436
    • 2020-11-28
    119 min

    [WAAA-012]My Husband's Former Boss Lives In The Same Company-Owned Apartment Building As Me (And He's A Super Horny Old Man) And Every Day, He's Sucking My Titties And Fucking Me In The Raw Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsWAAAwanz factorywanzWAAA-012WAAA012waaa00012
    • 2020-11-29
    97 min

    [DBVB-033]The Hermaphrodite Sensuality Development Research Center Part 2 When The Flesh Is Awakened To The Pleasures Of Lust, They Will Break Past The Limits Of Resistance And Enter The World Of Multiple Orgasms!

  • censoredanalDBVBbabyentertainmentvenus babyDBVB-033DBVB033dbvb00033
    • 2020-12-12
    119 min

    [MEYD-643]The Horny MILF At My Part-Time Job Is My Very Own Personal Cum Dumpster Ayaka Mochizuki

  • ayaka mochizuki censoredcreampiesquirtingMEYDtameike goroMEYD-643MEYD643meyd00643
    • 2020-12-15
    54 min

    FC2PPV 1607467 [Personal shooting] ♀286 Campaign Gal Hi ◯ Ri-chan 20 years old 1st time A daughter who has no night work experience appears again! A slender superb beauty conceives a vaginal cum shot and ends her life with her AV debut! (LOL)

  • amateur uncensoredfc2
    • 2020-12-17
    119 min

    [PPSD-055]After I Became The No.1 Swimmer In The Country, These Big Tits School Swimsuit Babes Came Begging For My DNA With Pregnancy Fetish Dreams In This Reverse Four-Way Slut Swimming School Fuck Fest

  • yoshine yuria natsuho imai censoredcreampiebig titsPPSDoppaiPPSD-055PPSD055ppsd00055
    • 2020-12-18
    73 min

    [JTDK-025]Mila.A / TOKYODOLL White Pin-Up Girl Mila.A

  • mila a censoredcosplaybeautiful girlJTDKtokyodoll tvtokyo doll tokyodoll tvJTDK-025JTDK025h-1524jtdk00025
    • 2020-12-21
    151 min

    [APKH-158]Beautiful Girl In Uniform Is A Secretly A Freaky Slut! Filthy POV Footage - Cum From A Spectacular Blowjob! She Cums Hard On Cock, And Will Stick Her Tongue In Your Anal Hole! Narumi Hirose

  • narumi hirose censoredcreampieschoolgirlAPKHaurora project annexhaurora project anexAPKH-158APKH158apkh00158
    • 2021-01-09
    209 min

    [KRU-104]Voyeur Videos From A Chiropractic Clinic In Meguro, Tokyo He Used A Powerful, Instant-Acting Aphrodisiac And Super-Stimulating Sensual Massage Techniques To Push This Beautiful Office Lady Beyond Any Attempts To Suppress Her Overflowing Lust

  • censoredcreampiebig titsKRUkarmamanji groupKRU-104KRU104kru00104
    • 2021-01-30
    155 min

    [WAAA-032]She Came, Over And Over Again, When He Fucked Her With The Biggest Dick Of Her Life... Large Orgies With Black Cock Creampies *A Big Dick Power Fuck Fest* - An Abnormally Horny Wife Who Won't Be Satisfied With Her Husband's Tiny Dic

  • ayaka mochizuki censoredslutsingle workWAAAwanz factorywanzWAAA-032WAAA032waaa00032
    • 2021-02-19
    120 min

    [SYKH-022]A Tall Married Woman With Beautiful Legs: Sensitive, Cumming, Fucking, Having Sex - Kannon-san, 27 Years Old

  • censoredcreampiemature womanSYKHleisurely missus emmanuelleSYKH-022SYKH022sykh00022
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-27
    240 min

    [JKSR-483]喉姦SEX 喉奥を犯●れた素人美女24人4時間

  • censoredamateurbeautiful girlJKSRbig mocalobockeyJKSR-483JKSR48357jksr00483
    • 2021-03-05
    122 min

    [ONEZ-276](Complete POV) Loving Sex With My Super Cute Girlfriend At A Hotel Aoi Nakajo

  • nakagusuku censoredcreampieblowjobONEZprestigeonezONEZ-276ONEZ276118onez00276
    • 2021-03-17
    61 min

    492MERC-275 Knowledge of H is almost zero 2

  • amateur censoredcreampieschoolgirlmercmerc-275merc275492merc-275
    • 2021-03-27
    95 min

    [VENX-020]Fucking My Hot Stepmother Raw While My Father Is Away On A Business Trip Toa Nanashima

  • toai nanami censoredcreampiemature womanVENXvenuspeterfakecest winntersVENX-020VENX020venx00020
    • 2021-04-03
    108 min

    390JAC-086 [Anal 2 Hole Climax x 2 Hole Creampie 5 Barrage] "Don’t run away from anal" Anal impact is activated! AT (anal trance) field fully open! Anal super runaway! Stick two longinus meat sticks! Transcendental half beauty awakening!

  • amateur censoredcreampieamateurjacjac-086jac086390jac-086
    • 2021-04-09
    201 min

    [IPX-634]FIRST IMPRESSION 148 Best In The Reiwa Era, Beautiful Y********l With Short Hair Who Doesn't Look Like A Porn Star Kotomi Ono

  • kotoyumi ono censoredblowjobbeautiful girlIPXidea pocketkyoseidishIPX-634IPX634ipx00634
    • 2021-04-14
    150 min

    [SSIS-049]Pretty Y********l With Big Tits Uta Hayano Can't Stop Cumming! First Time 4 Cum Shots

  • hayano uta censoredbeautiful girlsingle workSSISs1 no 1 stylemon cSSIS-049SSIS049ssis00049
    • 2021-04-16
    54 min

    FC2PPV 1773301 [Uncensored] When I met him for the first time in a long time, he turned into a super popular hostess, but Ji ● Po addiction does not heal Former J ● Refre Miss hostess: Mai (19 years old)

  • amateur uncensoredfc2
    • 2021-04-22
    65 min

    FC2PPV 1781358 [First shot appearance, demon Iki] G cup beauty big breasts Lori. Show off to passers-by and roll up with a large amount of squirting and adult gachinko sex! Remove the rubber from yourself and finish during life

  • amateur uncensoredfc2
    • 2021-04-24
    116 min

    [XVSR-591]I Want To Be Treated Like A Spoiled Baby By Motherly Mama Arisa! Arisa Hanyu

  • arisa hanyu arisu hanyu censoredcreampiebig titsXVSRmax aikuzo yoshidacalenXVSR-591XVSR591xvsr00591
    • 2021-04-24
    88 min

    300MAAN-647 [Brush down with Hamijiri maid costume] While being puzzled in front of her boyfriend, she is obedient enough to lick her virgin anal! !! In the end, immorality and excitement are inevitable to see yourself shaking your hips! Being pollut

  • amateur censoredcreampieamateurmaanmaan-647maan647300maan-647
    • 2021-05-14
    73 min

    259LUXU-1417 Luxury TV 1404 An experienced beautician who attracts not only men but also women appears in search of sex different from everyday life! If M is stimulated by a sticky word blame, the nasty nipple will keep erecting! Don’t miss the

  • amateur censoredamateurluxuluxu-1417luxu1417259luxu-1417
    • 2021-05-24
    64 min

    FC2PPV 1834271 [Leaked] [Immediate deletion of body baldness] Harajuku G Cup 18-year-old charismatic president Gonzo back video leaked [High-quality DL]

  • amateur uncensoredfc2
    • 2021-05-28
    162 min

    [MIFD-158]A Fresh Face Barely Legal Babe From Tohoku Is Making Her Adult Video Debut Her Family Runs An Apple Farm, And She's A Freshman In Tokyo Who Still Hasn't Gotten Rid Of Her Tsugaru Accent. Hey Mr. Adult Video Actor, I Want You To Fuck

  • mitsuki hirose censoredbeautiful girlsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-158MIFD158mifd00158
    • 2021-06-01
    121 min

    [NACR-423]My Brother's Wife Fell Into A Trap - Mirei Aikawa

  • aikawa mirei censoredcreampieblowjobNACRplanet plusdirector onanakuruNACR-423NACR423h-237nacr00423
    • 2021-06-04
    71 min

    FC2PPV 1817510 [God Lori] Active J ○ Chiabe Echi Echi Natural beautiful girl’s daddy activity SEX After school part-time job personal shooting

  • amateur uncensoredfc2
    • 2021-06-10
    64 min

    515BTGL-007 Hina (22)

  • amateur censoredanalcreampiebtglbtgl-007btgl007515btgl-007
    • 2021-07-08
    127 min

    [SPRD-1434]Mother-in-Law, You Are Suddenly Way Better Than My Wife... Aoi Aoyama.

  • aoyama censoredmature womansingle workSPRDtakara eizokon oriharualeddinSPRD-1434SPRD143418sprd01434
    • 2021-07-10
    124 min

    [MOPT-009]Submissive Men Are Made To Be Tied Up. Slut Turned On By Bondage. Mary Tachibana

  • tachibana mary censoredanalslutMOPTm o paradisemo tightMOPT-009MOPT009mopt00009
    • 2021-07-22
    118 min

    [MIDE-958]Strong-Willed Female Boss Regains The Pussy Of Her Youth When She Wears A School Uniform For The First Time In 10 Years! A Stud Like Me Was More Than Happy To Fuck Her All Night! Mizuki Aiga

  • mizuki ai censoredcreampieuniformMIDEmoodyzzaku araimoodyz divaMIDE-958MIDE958mide00958
    • 2021-07-30
    228 min

    [HUNTB-067]"Step-brother, are you hard？" My first experience with my step-sister who stole my virginity and semen...

  • censoredcreampiesisterHUNTBhunterborubo nakanohhh groupHUNTB-067HUNTB067huntb00067
    • 2021-08-13
    217 min

    [HUNTB-077]I"m In A Four-Way Secret Relationship With My Big Stepsister, Little Stepsister, My Step Niece, And My Step Cousins. 2 In The End, I Got Found Out, And So I Had Creampie Sex With All Of Them! And When My C***dhood Friend Saw What Was H

  • censoredcreampieHUNTBhunterkawajirihhh groupHUNTB-077HUNTB077huntb00077
    • 2021-08-14
    120 min

    [KSBJ-151]A Son"s Wife Was A Slut By Nature... Michiru Kujou.

  • kujo michiru censoredcreampieslutKSBJksb kikaku emmanuellesakura ninKSBJ-151KSBJ151ksbj00151
    • 2021-08-20
    118 min

    [NNPJ-464](Are Girls Who Go Out Alone Secretly Lonely？) After Picking Her Up And Bringing Her Home She Hasn"t Had Any In Ages!？ "Fuck Me More" An Older Girl Begs For A Hard Pounding.

  • censoredcreampieamateurNNPJnampa japanNNPJ-464NNPJ464nnpj00464
    • 2021-08-27
    242 min

    [SKMJ-198]We Met This Gal In A Swimsuit At The Beach In Shonan, And Now She"s Here Taking The "Pussy Grinding Oil Massage" Challenge With A Big Dick Cherry Boy! When She Got His Slick And Slippery Big Cock Rubbed Against Her Raw Pussy, Sh

  • censoredcreampiebig titsSKMJsekimenjoshiasmaxsekimen goshiSKMJ-198SKMJ198h-1324skmj00198
    • 2021-09-03
    122 min

    [ATID-478]These Two S*****ts (They"re Both Gal Bitches) Were So Naughty And Haughty That I Needed To Teach Them A Lesson, So I Got Them Hooked On Sex, And Now I Have Them In My Employ As My Own Personal Obedient Sex Toys. Sora Minamino Aoi Kururu

  • minano sora aoi kururugi censoreduniformbeautiful girlATIDattackersdoragon nishikawain madATID-478ATID478atid00478
    • 2021-09-04
    240 min

    [MMMB-056]Tight Leggings Hugging Her Ass And Pussy. Pimply Huge Ass And Legs Housewife 4 Hours

  • censoredbig titsMMMBmellow moonMMMB-056MMMB056mmmb00056
    • 2021-09-10
    177 min

    [IPX-722]The End Of Abstinence: For 3 Days, Covered With Sweat And Climax Juices - Hikari Azusa

  • azusa hikari censoredsquirtingbeautiful girlIPXidea pocketinaballdishIPX-722IPX722ipx00722
    • 2021-09-24
    205 min

    [HUNTB-098]A Bunch Of Easy Girls From School Made Me Participate In Their Pov Porn As Part Of The Yearbook. We Went All Over School Recording Ourselves Fucking, With Me In The Starring Role As The One With A Dick.

  • censoredcreampieschoolgirlHUNTBhunterkoichi davidsonhhh groupHUNTB-098HUNTB098huntb00098
    • 2021-09-24
    149 min

    [AKID-087]Horny Insta-Fuck Girls Only We Took The Home For A Peeping Good Time And Then We Sold The Footage Without Permission As An Adult Video No.46 Emi / G-Cup Titties / 26 Years Old / Height: 165cm Nanae / D-Cup Titties / 23 Years Old / Height: 1

  • censoredcreampieblowjobAKIDomochikaeri mousozokumanji groupAKID-087AKID087akid00087
    • 2021-09-29
    46 min

    481SACZ-063 Yuko 5

  • amateur censoredamateurbdsmsaczsacz-063sacz063481sacz-063
    • 2021-10-02
    61 min

    Caribbeancom 100221-001 The Luxury Adult Spa: Today My Pussy Belongs To You Misa Makise

  • misa makise uncensoredcreampiehandjobcaribbeancom
    • 2021-10-07
    128 min

    [HBAD-597]Naive, Uptight Yet Clumsy New Girl Has Amazing Big Tits On A Top Tier Body. The Constant Belittling From The Lewd Guys In Management Teaches Her The Ways Of Submissive Sexual Pleasure. Umi Natsukawa

  • umi natsukawa censoredbig titssingle workHBADhibinoumanami jirobabeHBAD-597HBAD5971hbad00597
    • 2021-10-29
    195 min

    [MIDE-989]Of Course It"s Embarrassing, But It"s Time For Some Hardcore Sex Training! Nothing But First Experiences! A Sensuality-Awakening 3-Fuck Special Mio Ishikawa

  • ishikawa mio censoredblowjobbeautiful girlMIDEmoodyzusapyonmoodyz divaMIDE-989MIDE989mide00989



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download