nana maeno




FC2NACXVEMACAWDSSISWANZROYDLULUBLKBBANMIDEHDKAMEYDNATRFSDSSADNPREDONEZEBODJUFESPRD

2021-01-12
59 min

HEYZO 2434 Exploring Every Corner Of A Fair Skin Girl! – Rin Aizawa

  • rin aizawa uncensoredcreampieheyzo
    • 2021-01-22
    78 min

    300MAAN-619 [Gentle local beauty JD / Iki tide! Saddle tide! Arashi / 4 shots of the whole body] At first glance I thought it was a normal JD who came to sightseeing from Miyagi … It was a perverted libido monster that loves sperm, denma, and bi

  • amateur censoredcreampiesquirtingmaanmaan-619maan619300maan-619
    • 2021-01-29
    234 min

    [NATR-650]Cute And Curvy! Ka Ayano Fuji

  • ayano kato censoredcreampiebig titsNATRnadeshikoNATR-650NATR650h-067natr00650
    • 2021-01-29
    21 min

    495MOJ-007 Yuzuki

  • amateur censoredcreampieamateurmojmoj-007moj007moj-007
    • 2021-01-29
    60 min

    300NTK-509 Cuter than an idol ♪ Private room photo session with a slender sensitive beautiful girl! !! God ● Smile and it’s just Kyun! !! The moment you emphasize the finest ass, you will naturally shift to naughty shooting with electric massage

  • amateur censoredcreampiesquirtingntkntk-509ntk509300ntk-509
    • 2021-01-30
    152 min

    [MIDE-876]Rough G*******g Sex With A Female Teacher - Rough Deep Throat/Group Shaming - Nana Yagi

  • nana yagi censoredblowjobsingle workMIDEmoodyzbungo maedamoodyz divaMIDE-876MIDE876mide00876
    • 2021-02-11
    191 min

    [HAWA-237]A Cuckold Investigation "I Want To Film My Wife While She's Looking Her Best" If A Video Instructor Is Teaching A Private Camera Lesson And Left Alone With A Big Tits Wife In A Micro Bikini... Will They Have Sex？ vol. 2

  • censoredbig titsHAWAcosmos eizohidemonkcosmospictures soft on demandHAWA-237HAWA2371hawa00237
    • 2021-02-26
    320 min

    [SKMJ-151]Actual Slutty Bitch Breaking In Fertilization Party!

  • censoredamateurmature womanSKMJblushSKMJ-151SKMJ151h-1324skmj00151
    • 2021-02-28
    105 min

    [VENX-012]2 Days And 1 Night Spent With My Wife's Sister Who Suddenly Came On To Me - Natsuho Imai

  • natsuho imai censoredcreampiebig titsVENXvenuskaniefakecest winntersVENX-012VENX012venx00012
    • 2021-03-06
    155 min

    [SSIS-010]My Girlfriend Was Gone For Two Days, So I Banged Her Actress Buddy From Dusk Until Dawn. Riri Nanatsumori

  • nanatsumori riri censoredbig titssingle workSSISs1 no 1 stylemon cSSIS-010SSIS010ssis00010
    • 2021-03-10
    30 min

    FC2PPV 1720679 [Individual shooting] [4K high image quality] Prefectural Ordinary Course FJK A curious black-haired beautiful girl who doesn’t feel like using her pussy! Natural pink pussy with beautiful nipples Full view wIO only slippery / Suj

  • amateur uncensoredfc2
    • 2021-03-27
    153 min

    [MMKZ-093]No One Can Resist My Step Sister's Filthy Big Ass! Yuri Honma

  • really censoredbig titssingle workMMKZmarrionkojiro miyamotoirisMMKZ-093MMKZ093mmkz00093
    • 2021-04-18
    125 min

    [PGFS-002]Destruction Of A Mother With Breast Milk: 2nd Woman - Eiko Hanatsuka

  • eiko hanatsuka censoredcreampiedeepthroatPGFStoyohikozarakiseiunkai ekusutorimuPGFS-002PGFS002pgfs00002
    • 2021-04-18
    142 min

    [AGAV-054]A Shamed, Soft And Puffy Bitch - When She Gets Hot And Horny, This Slutty Office Lady Will Fuck Anybody, And Now She's Baring Her Basic Instinct To Fuck - Yuha Kiriyama

  • kiriyama yuu censoredsquirtingbeautiful girlAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-054AGAV054agav00054
    • 2021-04-23
    160 min

    [JUFE-283]POV Footage Of Male Subs Getting Fucked! Beautiful Young Dual Succubi Tease Guys Until They Squirt! Wan Horikita Marina Saito

  • horikita wan marina saito censoredsquirtingschoolgirlJUFEfitchsamoariJUFE-283JUFE283jufe00283
    • 2021-05-01
    119 min

    [JUL-570]Twice A Week, My Excessively Horny Stepfather Has Been Fucking My Stepmom But Now, She's Going Behind His Back And Enjoying A Younger Man's Cock (Mine) With Deep And Rich, Slow Creampie Sex Ai Mukai

  • ai mukai censoredcreampiemature womanJULmadonnarokusaburo mishimaJUL-570JUL570jul00570
    • 2021-05-07
    120 min

    [EBOD-822]Former Idol's Porn Baptism! A Real Idol Gets Nailed In Front Of Her Real Fans With Nasty Orgasms Ami Yozora

  • ami yozora censoredbig titssquirtingEBODe bodytrendy yamaguchiEBOD-822EBOD822ebod00822
    • 2021-05-07
    120 min

    [FSDSS-221]She Cums Instantly, As She Always Plays With Her Clit To Keep Herself On The Edge Of Climax - Masho Arisaka

  • arisaka mayoi censoredbig titsbeautiful girlFSDSSfalenoyamaguchi memberfaleno starFSDSS-221FSDSS2211fsdss00221
    • 2021-05-08
    108 min

    [MOPG-069]It'd Be Great If She Was The Kind Of Nasty Slut Who'd Choke Me While Teasing My Nipples. Rian Isaki

  • rian isagi censoredanalslutMOPGm o paradisemo goldMOPG-069MOPG069mopg00069
    • 2021-05-09
    74 min

    300MAAN-651 [Woman with two Ma ○ Ko] Overwhelming beauty’s mouth Ma ○ The best blowjob that comes out from this, and the Yarichin man who is a hundred battles is also outbursts! !! A small devil girl who is inevitable in love blames herself with

  • amateur censoredbig titsamateurmaanmaan-651maan651300maan-651
    • 2021-05-18
    59 min

    FC2PPV 1823328 [No] Emergency appearance of an active hostess! !! Enjoy a slippery body that you can not usually hold no matter how much money you spend, and a large amount of vaginal cum shot! [Individual shooting]

  • amateur uncensoredfc2
    • 2021-05-28
    121 min

    [MIAA-444]Teaching A Super Impertinent Brat A Lesson By Grabbing Her And Fucking Her Hard Ichika Matsumoto

  • ichika matsumoto censoredcreampiedeepthroatMIAAmoodyzsuisei akaieveryone s porn starMIAA-444MIAA444miaa00444
    • 2021-06-10
    133 min

    [IENF-146]Picking Up Real Amateur Wives - Would You Help Wash A Male Virgin's Stuck Foreskin？ It's Been Ages Since She's Seen A Hard Cock, So She's Ecstatic To Break Him In!

  • aichi michiru yamamoto renka censoredcreampiebig titsIENFienergytiger kosakaiienfIENF-146IENF1461ienf00146
    • 2021-06-15
    135 min

    [BNST-030]Damn! A Nipple Pervert and Little Devil in a Uniform Who Grabs Nipples. Hana Shiramomo.

  • white peach censoreduniformbeautiful girlBNSTthere is alsoteacher mousouzokuBNST-030BNST030bnst00030
    • 2021-06-20
    112 min

    [XRL-012]Idol Applicant Training Course: Father's Interview! With Hikaru Minazuki

  • hikaru minazuki censoredcreampiedeepthroatXRLreal worksreal real worksXRL-012XRL012xrl00012
    • 2021-07-05
    74 min

    259LUXU-1427 Luxury TV 1426 "My body is aching …" I have been sexless for 3 years and my desires have accumulated and my body is the limit of patience! A horny wife who exposes her sensitive big tits and big butt, accepts other sticks an

  • amateur censoredbig titsmarried womanluxuluxu-1427luxu1427259luxu-1427
    • 2021-07-06
    47 min

    FC2PPV 1886884 [Personal shooting] Tomohame! I took a gonzo like a friend ☆ Yurie 36 years old ☆

  • amateur uncensoredfc2
    • 2021-08-13
    245 min

    [DVDMS-702]Ordinary Guys And Girls Caught On Camera - Shocking Hook-Ups After The Class Reunion! Will These Former Classmates Who Haven"t Seen Each Other For 10 Years Be Willing To Bang At A Love Hotel？! What About If We Offered Them One Grand Fo

  • censoredcreampiebig titsDVDMSdeepsiwanagadeep sDVDMS-702DVDMS702dvdms00702
    • 2021-09-03
    179 min

    [MIFD-176]Newcomer, 19 And Half, Y********l. She Wants To Be An Adult. JAV DEBUT Kazuna Yuuki

  • kazuna yuki censoredbeautiful girlsingle workMIFDmoodyzusapyonmoodyz freshMIFD-176MIFD176mifd00176
    • 2021-09-04
    240 min

    [YMDD-243]I Can Only Pretend To Be A Good Girl So Long -Best of Mao Kurata -

  • kurata mao censoredcreampiebig titsYMDDmomotarou eizou shuppanishikiribashi hakasejaku momoYMDD-243YMDD243ymdd00243
    • 2021-09-24
    205 min

    [HUNTB-102][What Are You Doing？! I Wanted My Girlfriend To Pop My Cherry!] A Perverted Younger Step-Sister Barging Into Her Step-Brother"s Room To Steal His Virginity

  • censoredcreampieschoolgirlHUNTBhunterborubo nakanohhh groupHUNTB-102HUNTB102huntb00102
    • 2021-10-01
    194 min

    [WAAA-099]If You Can Withstand Kana Yume "s Amazing Technique, You Get To Have Raw Creampie SEX With Her!

  • kana yui censoredcreampieblowjobWAAAwanz factoryWAAA-099WAAA099waaa00099
    • 2021-10-09
    161 min

    [SABA-727]Welcome, Virgins! Sweet As An Angel, Current Caregiver, Challenge The Mission! Breast-feeding Handjobs And Boob Hugs! I"m Going To Have A Great Time With You! vol. 002

  • censoredcreampieblowjobSABAs kyuu shiroutotodoSABA-727SABA727saba00727
    • 2021-10-14
    63 min

    FCP-048 [Delivery Only] Absolutely Subjective! !! Sperm Is Almost Exhausted! Super Feeling Good! !! Nipple Licking Handjob ＃ 5

  • amateur censoredamateurbeautiful girlfcpfcp-048fcp048fcp-048
    • 2021-10-15
    146 min

    [MUDR-166]It"s After School. This Girl Looked Like A Pushover, So We Took Her, And Surrounded Her With A Ring Of Dirty Old Men, And Soiled Her With Bukkake, Relentlessly, Over And Over And Over Again ... Hikaru Minazuki

  • hikaru minazuki censoredblowjobsingle workMUDRmukuMUDR-166MUDR166mudr00166
    • 2021-10-15
    163 min

    [EBOD-865]Fwap Fwap Squeezed Between Colossal Tits!! Healthy Curvy Older Sister Gives Me An Energetic Titty Fuck

  • censoredbig titsEBODe bodykyouseiEBOD-865EBOD865ebod00865
    • 2021-10-21
    135 min

    [STARS-463]最高なロシアハーフの愛人(19)と朝までイチャイチャ交わり合う出張不倫お泊りデート。 アンナ

  • anna censoredSTARSsod createmonsod starSTARS-463STARS463
    • 2021-10-21
    125 min

    [JURA-043]Wife Mitabi, First Time in Her 50s. Reiko Seo

  • reiko seo censoredcreampiemarried womanJURAcenter villagesouthern earthjurakuJURA-043JURA043h-086jura00043
    • 2021-10-23
    146 min

    [PCDE-013]A Video Record Of The Activities Of A Certain Otaku 13

  • igarashi yui natsuhara censoredcosplayPCDEcp denen mousouzokucp denentoaru otaku no katsudou kirokuPCDE-013PCDE013pcde00013
    • 2021-10-23
    79 min

    200GANA-2584 Seriously Nampa, First Shot. 1706 Cusso Cute And Fashionable, But A Gamer And Neat Gap! Slender, Beautiful Legs, Nice Ass And Big Breasts! The Expression That Is Distorted Every Time The Sensitivity Is Also Preeminently Struck! This Woma

  • amateur censoredbig titsamateurganagana-2584gana2584200gana-2584
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-10-29
    124 min

    [CAWD-311]Light Skin Girl With Black Hair And Hot Nipples Takes A Big Dick For The First Time, Giving Her A Deep Penetrating Orgasm! This Beautiful Girl Comes From Tohuku, Home Of Light Skin Beauties. Mikuru Mashiro Makes Her Debut.

  • pure white mikuru censoredsingle workCAWDkawaiikimura hiroyukiCAWD-311CAWD311cawd00311
    • 2021-11-16
    60 min

    [HEYZO-2657]Jessica Takizawa Orgasms With A Horny Pussy Girl Vol.23

  • amateur uncensoredcreampieheyzo
    • 2021-11-20
    128 min

    [BAB-037]An Unprotected Sex Tour with a Sugar Daddy. Natural Airhead and Very Beautiful Pussy GAL. Iroha Minami

  • minami iroha censoredsingle workBABbabylon daydreamersBAB-037BAB037bab00037
    • 2021-11-27
    40 min

    H0930 ki211128 Chisato Miura 40years old

  • amateur uncensoredh0930
    • 2021-11-29
    68 min

    [SHN-069]Touching OK! Girls 2021 Cosplay Girl Fucked At The Culture Festival And Her Hips Start Moving On Their Own

  • censoredbig titsblowjobSHNnatural highitaka smithlin powdernatsu carefully selected daughterSHN-069SHN0691shn00069
    • 2021-12-02
    148 min

    [MILK-129]Riona Minami 10th Anniversary Film - The Path I"ve Taken with My Fans - May 10 Years of Thank You"s Reach Everyone

  • rina minami censoredcreampieblowjobMILKmilkMILK-129MILK129h-1240milk00129
    • 2021-12-24
    116 min

    [URE-076]Very Popular! Live-action Adaptation Of The Royal Netorare Doujin By Minami Hatsukawa! Based On The Book By Haidoku-sensei: What You Want

  • hatsukawa minami censoredmature womansingle workUREmadonnadragon nishikawaure.comiURE-076URE076ure00076



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download