nagase




FC2CAWDLULUATIDHUNTBJUFEPREDDASDNACRMIDVGVHNATRMIDESHKDHMNHZGDAUKGHODVMILKBBANAUKG

2020-02-22
120 min

[DASD-643]Her Tongue Feels As Good As Her Pussy When She Gets Kissed By Her Boyfriend's Dad - Yui Nagase

  • yui nagase censoredbeautiful girlDASDdassrokusaburo mishimaDASD-643DASD643dasd00643
    • 2020-02-22
    118 min

    [HNDS-068]If She Makes A Sound, She'll Get Creampied! - Beautiful Y********ls Test Their Will Against Guys' Pregnancy Fetishes

  • hasumi claire blue censoredcreampieuniformHNDShon nakatiger kosakaiHNDS-068HNDS068hnds00068
    • 2020-02-22
    121 min

    [HND-796]I Get Revenge On My Stepsister Who Always Treats Me Like A Creep By Covering Her Face In Sweat, Spit, And Cum - Yui Nagase

  • yui nagase censoredcreampiebeautiful girlHNDbooktanaka baconHND-796HND796hnd00796
    • 2020-02-20
    160 min

    [IENF-062]I Was Pulling Pranks On My S******g S********l Little Sister, But Then She Started Demanding A Raw Fuck, And I Wanted To Unload My Cum, But She Locked Her Legs Around Me In A Crab Hold And Kept Me There Until I Had To Creampie Her! 4

  • misaki minami mari takasugi censoredcreampieschoolgirlIENFienergykikurinieneIENF-062IENF0621ienf00062
    • 2020-02-20
    242 min

    [HAWA-202]She's Having Sex With Other Men Behind Her Husband's Back "The Truth Is, I've Never Swallowed My Husband's Cum" She's Over 30 And D***king Cum For The First Time Special Edition She's Begging To Get It In

  • censoredanaldeepthroatHAWAcosmos eizohawai nagasecosmospictures soft on demandHAWA-202HAWA2021hawa00202
    • 2020-02-20
    27 min

    [GRCH-350]Creampie Cheating Right Next To My Best Friend - I Didn't Want To Cum, But I Did - Hiromi Nagase x Suzu Yamai

  • suzu yamai hiroomi nagase censoredsingle workdramaGRCHgirl s chsofeyGRCH-350GRCH3501grch00350
    • 2020-02-16
    113 min

    [TIKB-070]I Made A Gal Down An Aphrodisiac And Then She Became Completely Crazy For My Cock LOL - Yui Nagase

  • yui nagase censoredschoolgirlbeautiful girlTIKBtikitiki.comerno directorno labelTIKB-070TIKB070tikb00070
    • 2020-02-15
    120 min

    [BLK-447]Step-Dad Takes Revenge On His Rebellious Young Step-Daughter In A School Uniform! She Cums Hard On His Dick As He Spanks Her From Behind Yui Nagase

  • yui nagase censoredcreampiedeepthroatBLKkira kirano directorkira kira black galBLK-447BLK447blk00447
    • 2020-02-15
    160 min

    [DVDMS-506]Having A Quickie With The Fair-Skinned Big-Assed Cleaning Woman! She Loved My Big Dick So Much She Came Back The Next Day For More

  • censoredcreampieamateurDVDMSdeep sswing nagaseDVDMS-506DVDMS506dvdms00506
    • 2020-02-14
    150 min

    [MDBK-086]Repeat Business Guaranteed!! A Beautiful Girl In Uniform Image Club Creampie Sex Service

  • inaba yui nagase censoredcreampiebig titsMDBKmedia stationmatsubara lemonbazookaMDBK-086MDBK08661mdbk00086
    • 2020-02-14
    122 min

    [VRTM-481]Sister Brainwashed And Turned Into Stepdad's Toys... 2

  • yui nagase toua kotone censoredcreampiesisterVRTMv r produceolive yoshidaVRTM-481VRTM481h-910vrtm00481
    • 2020-02-14
    117 min

    [REAL-720]Furious Fucking My Wife And Daughter Had Nothing To Do With It, But They Got Revenge Fucked Anyway Yu Shinoda Yui Nagase

  • shinoda yu yui nagase censoredREALreal worksjohnny shibuyareal real worksREAL-720REAL720172real00720
    • 2020-02-13
    183 min

    [GRCH-2801]Girl's Channel - 5 Years - Best Selection Chosen By Users - Reprint Edition

  • yoshihiko arima hiroomi nagase censoreddramaGRCHgirl s chGRCH-2801GRCH28011grch02801
    • 2020-02-09
    300 min

    [DVAJ-440]First Love 5 Hours 15 Women Who Desperately Try To Resist These Evil Cocks, Entering Their Innocent Pussies

  • kawakami nanami kirishima sakura censoredbeautiful girlDVAJalice japansagi kandaDVAJ-440DVAJ440dvaj00440
    • 2020-02-08
    150 min

    [JUFE-145]A Helpless Colossal Tits Big Stepsister Gets Fucked Out Of Her Mind By Her Ultra Orgasmic Little Stepbrother She Was Planning To Lure Her Cherry Boy Little Stepbrother To Temptation... But The Tables Were Turned! Mami Nagase

  • asami nagase censoredcreampiebig titsJUFEfitchJUFE-145JUFE145jufe00145
    • 2020-02-08
    119 min

    [MIAA-225]A What If Regretful NTR Video My S*****t Kept On Cumming On To Me, And I Did My Best To Resist Her, But Then She Started Dating A Perverted Old Man Janitor Instead Yui Nagase

  • yui nagase censoredcreampieschoolgirlMIAAmoodyzryo inugamieveryone s porn starMIAA-225MIAA225miaa00225
    • 2020-02-07
    153 min

    [ABP-946]Newest Beauty Salon Addict Offered By Minamo Nagase 48 - We Meet All Our Customers' Desires And Provide The Ultimate Refreshing Experience With Our Tight Pussies!!

  • minase nagase censoredbig titscosplayABPprestigecharlie tanakaabsolutely perfectABP-946ABP946118abp00946
    • 2020-02-06
    42 min

    [GRCH-347]Dominating A Masochistic Slut Yuha Kiriyama H\

  • kiriyama yuu hiroomi nagase censoredslutsingle workGRCHgirl s chno directorGRCH-347GRCH3471grch00347
    • 2020-02-06
    129 min

    [NITR-489]The Collapse Of Youth! - Fucking A Stand-In Lover 2 - Yui Nagase

  • yui nagase censoredcreampieuniformNITRcrystal pictureadrenalinenitroNITR-489NITR48949nitr00489
    • 2020-02-01
    160 min

    [DVDMS-502]Amateur Documentary Porn: Some Tipsy Higher Ups From Work With Colossal Tits Came Over To Have Fun. I Hit On Them, Then They Got Creampied Until Morning

  • censoredcreampiebig titsDVDMSdeep sswing nagaseDVDMS-502DVDMS502dvdms00502
    • 2020-01-27
    51 min

    [HSAM-001]My Little Stepsister Was Slipped Some Aphrodisiacs And That Got Her All Hot And Bothered Yui Nagase

  • yui nagase censoreduniformsisterHSAMsod createsoran kobayashishowing her face shy amateurHSAM-001HSAM0011hsam00001
    • 2020-01-25
    148 min

    [MIAA-217]I'm A Premature Ejaculator And Bad At Sex But Once I Got My Hands On These "Reverse Effects " I Can Now Teach You How To Train These Naughty And Haughty Bitches In Uniform And Make Them Cum With Piston-Pounding Power Even If You

  • yui nagase censoreduniformschoolgirlMIAAmoody skawane kawaguchikikatan for everyoneMIAA-217MIAA217miaa00217
    • 2020-01-23
    212 min

    [HAWA-199]A Sensual Amateur Wife Who Seeks More Stimulation Is Getting Orgasmic Pleasure From Both Men And Women SEX HAWA 199

  • censoredamateurlesbianHAWAcosmos eizohawai nagasecosmospictures soft on demandHAWA-199HAWA1991hawa00199
    • 2020-01-23
    21 min

    [GRCH-345]Dripping Wet Office Love - On A Rainy Stormy Night, I Was Trapped In The Office With My Colleague, Whom I Had Feelings For... And Now I Could No Longer Resist The Temptation... - Mizuki Hayakawa

  • mizuki hayakawa hiroomi nagase censoredsingle workdramaGRCHgirl s chhiroko sabueGRCH-345GRCH3451grch00345
    • 2020-01-19
    141 min

    [DASD-624]When Our Parents Went Away For Two Days, I Fucked My Horny Little Stepsister And Creampied Her - Yui Nagase

  • yui nagase censoredcreampiesisterDASDdasjo asagiriDASD-624DASD624dasd00624
    • 2020-01-16
    121 min

    [MVSD-416]My Niece Is Hooked On Clitoris Masturbation, So I Decided To Teach Her The Benefits Of Cumming Inside And Creampie Sex Yui Nagase

  • yui nagase censoredcreampiesquirtingMVSDm s video grouprokusaburo mishimaMVSD-416MVSD416mvsd00416
    • 2020-01-16
    37 min

    [GRCH-344]Reverse NTR (Cuckold Fucking) I Was About To Get Married... When This Bitchy Office Lady Colleague Deceived Me Into Having Creampie Sex

  • mizuki hayakawa hiroomi nagase censoredcreampiesingle workGRCHgirl s chsofeyGRCH-344GRCH3441grch00344
    • 2020-01-14
    120 min

    [KTRA-183]A Girl With Small Tits Gets Creampied - Yui Nagase

  • yui nagase censoredcreampiebeautiful girlKTRAk tribeKTRA-183KTRA183h-094ktra00183
    • 2020-01-11
    135 min

    [MIAA-213]I Ran Away From Home And This Dirty Old Man Took Me In, And For 24 Hours, Until I Was Finally Released, I Was Transformed Into A Orgasmic Body Through Sweaty Sex Yui Nagase

  • yui nagase censoredschoolgirlsingle workMIAAmoodyzmametaro mamezawaeveryone s porn starMIAA-213MIAA213miaa00213
    • 2020-01-11
    148 min

    [MIRD-200]Her Uniform Is Soaking Wet, So She Had To Get Out Of The Rain My Big Stepsister And Her 10 Friends Were Soaking Wet And I Could See Through Their Clothes, And They Attacked Me And Creampie Fucked Me One Rainy Afternoon After School

  • scooping yui nagase censoredcreampieschoolgirlMIRDmoodyzkitorune kawaguchimoodyz realMIRD-200MIRD200mird00200
    • 2020-01-11
    120 min

    [MEYD-564]Frustrated Apartment Wife And Old Man With A Pregnancy Fetish Engage In Hot And Sweaty Adulterous Sex With A Creampie Finish Yui Nagase

  • yui nagase censoredcreampiesingle workMEYDtameike gorohirokoji osakiMEYD-564MEYD564meyd00564
    • 2020-01-09
    264 min

    [MIST-289]Creampie Raw Footage Cowgirl Sex With A Nipple Tweaking Delivery Health Call Girl 5

  • misaki azusa haruna hana censoredcreampieMISTmr michiruMIST-289MIST2891mist00289
    • 2020-01-09
    50 min

    [GRCH-341]Peeping At A Love Hotel - Fucked In Front Of Their Boyfriends - Perverted Couples Who Get Off On Swapping

  • makoto ito airi tsukishita censoredbig titsGRCHgirl s chhiroko sabueGRCH-341GRCH3411grch00341
    • 2020-01-05
    67 min

    [010520_236]Hitomi Nagase

  • hitomi nagase uncensoredcreampieblowjobpacopacomama
    • 2020-01-03
    178 min

    [ABP-938]First Time - Trance, Strong Orgasm Fuck 51 The Other Side Of Cumming. Minamo Nagase

  • minase nagase censoredsquirtingsingle workABPprestigemanhattan kimuraabsolutely perfectABP-938ABP938118abp00938
    • 2020-01-01
    135 min

    [GVH-004]Betrayal Graduation Trip: Yui Nagase

  • yui nagase censoredbdsmsingle workGVHglory questchintaGVH-004GVH00413gvh00004
    • 2019-12-28
    147 min

    [DVDMS-490]A Normal Boys And Girls Documentary Adult Video This Big Ass Beautiful Mature Woman Who Came From China To Tour Japan Was Using My Place As Her Own BnB, And From That Day Until The Day She Went Back Home I Fucked Her Raw, Over And Over Aga

  • censoredcreampieamateurDVDMSdeep sswing nagaseDVDMS-490DVDMS490dvdms00490
    • 2019-12-28
    100 min

    [SHKD-885]Female Body Swap Investigator 2 Mami Nagase

  • asami nagase censoredSHKDattackerskindeath night evilSHKD-885SHKD885shkd00885
    • 2019-12-27
    486 min

    [PPT-086]Minamo Nagase 8 Hours BEST PRESTIGE PREMIUM TREASURE Vol. 01 All 6 Videos + Unreleased Video Tracing Minamo Nagase's Career

  • minase nagase censoredbig titscosplayPPTprestigeprestige premium treasurePPT-086PPT086118ppt00086
    • 2019-12-27
    167 min

    [MKMP-310]A Slutty S********l Commits Creampie Electoral Dirty Deeds In Order To Become S*****t Council President!!

  • inaba yui nagase censoredcreampieblowjobMKMPkm producequatcheemillionMKMP-310MKMP31084mkmp00310
    • 2019-12-27
    127 min

    [IBW-759]A Y********l Gets Repeatedly B*****p By Her Stepfather - Yui Nagase

  • yui nagase censoredIBWi b worksIBW-759IBW759
    • 2019-12-26
    122 min

    [IENF-048]Yui Nagase - Baby-Making With A S*****t - Newly Wed Lifestyle

  • yui nagase censoredcreampieuniformIENFi energychrysanthemumieneIENF-048IENF0481ienf00048
    • 2019-12-26
    244 min

    [HAWA-196]A Married Woman's Secret Sex Life "I've Never Even Swallowed My Husband's Cum" 30-Something Guzzles For The First Time Extended Edition

  • censoredmarried womansquirtingHAWAcosmos videonagase hawaiicosmospictures soft on demandHAWA-196HAWA1961hawa00196
    • 2019-12-22
    201 min

    [MIRD-199]Total Domain The Allure Of A Beautiful Girl Harlem School 3 You'll Be Trapped By These Silky Smooth Thighs And Unable To Move And Made To Ejaculate Over And Over Again!

  • yui nagase scooping censoredschoolgirlbeautiful girlMIRDmoodyznao masakimoodyz realMIRD-199MIRD199mird00199
    • 2019-12-22
    237 min

    [MIZD-168]Always Twisting Nipples For The Ultimate Cumshot!! Nipple Teasing Slut Rush 4 Hours vol. 2

  • shinoda yu emi fukada censoredsluthandjobMIZDmoodyzmoodyz bestMIZD-168MIZD168mizd00168
    • 2019-12-20
    126 min

    [AVSA-115]A Female S*****t Idol Who Will Give You Creampie Sex Yui And A Dirty Old Man In A Video Record Of Impregnation Breaking In Sex Yui Nagase

  • yui nagase censoredcreampiesingle workAVSAavs collector shiroyuki kimuraavscollector sAVSA-115AVSA115avsa00115
    • 2019-12-19
    182 min

    [DASD-616]She's Drooling All Over You While Shaking Her Ass A Sleepover Vacation Where She Bares Her True Self "A Beautiful Woman Cunt Tradeoff, In A Young/Old In-N-Out Lusty Swapping Fuck Fest" Rui Hiiragi Yui Nagase

  • scolding yui nagase censoredbig titsbeautiful girlDASDdasrokusaburo mishimaDASD-616DASD616dasd00616
    • 2019-12-19
    151 min

    [HND-769]Celebate Woman And Peerless Man's Raw Awakening! Instinct Laid Bare, Genuine Creampie Intercourse! Mami Nagase

  • asami nagase censoredcreampiebig titsHNDhon nakamichiru arashiyamaHND-769HND769hnd00769



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download