minato




FC2HZGDVENXAUKSATIDSSISCAWDPPPDGVHDASDAUKGAPODMEYDSHKDVEMASPRDAWDPREDAVSAMIDVVENU

2020-11-23
133 min

[ANZD-048]She Has Fucked Over 1000 Guys! She Goes To Social Mixers Every Day Looking For Men To Fuck - Super Aggressive Girl Yuu

  • censoredcreampieamateurANZDanzu daydream vacationanzuANZD-048ANZD048anzd00048
    • 2020-12-03
    92 min

    [hoi-148]胡桃(21)

  • amateur censoredamateurbeautiful girlhoihoi-148hoi148hoi-148
    • 2020-12-05
    61 min

    Caribbeancom 120520-001 Special Lesson After School: I was wet whole day even during classes at school..Mika Takagi

  • mika takagi uncensoredcreampiecaribbeancom
    • 2020-12-05
    57 min

    H0930 ori1589 Miki Ido 34years old

  • amateur uncensoredh0930
    • 2020-12-07
    83 min

    259LUXU-1349 Luxury TV 1336 Masturbation frequency twice daily! ？？ Is it the nature of the job of a nurse who has few encounters？ Pay attention to the appearance that the sexual desire that can not be resolved is disturbed only with Hara-san!

  • amateur censoredamateurluxuluxu-1349luxu1349259luxu-1349
    • 2020-12-07
    51 min

    [gerk-335]ゆうか先輩

  • amateur censoredcreampiebig titsgerkgerk-335gerk335gerk-335
    • 2020-12-10
    65 min

    [orex-190]まやちゃん

  • amateur censoredcreampieschoolgirlorexorex-190orex190orex-190
    • 2020-12-11
    56 min

    [ykmc-043]まや(20)

  • amateur censoredcreampieamateurykmcykmc-043ykmc043ykmc-043
    • 2020-12-12
    115 min

    [EBOD-788]My Girlfriend's Big Tits Little Stepsister Tagged Along On Our Vacation And Secretly Lured Me To Temptation By Flashing Her I-Cup Titties At Me From Underneath Her Yukata Kimono When She Came Out Of The Bath, And Fucked Me For 2 Days St

  • yukino nagi shiraishi plane censoredcreampiebig titsEBODe bodytake dEBOD-788EBOD788ebod00788
    • 2020-12-17
    478 min

    [OFJE-288]Rara Anzai 2nd BEST Collection

  • anzai rara censoredbig titssingle workOFJEs1 no 1 styleOFJE-288OFJE288ofje00288
    • 2020-12-25
    216 min

    [SKMJ-137]College Girl Amateurs Clean Filthy Cocks With Their Own Holes! With The Tip Lovingly Scrubbed By The Back Door This Huge Cock Is Shoved Into Her Dripping Pussy For The Rinse Cycle! Then All The Way To Her Womb For Some Hard Pounding Creampi

  • censoredcreampieamateurSKMJred face girlone topSKMJ-137SKMJ137h-1324skmj00137
    • 2020-12-26

    C0930 ki201226 Self Shot

  • amateur uncensoredc0930
    • 2021-01-02
    43 min

    FC2PPV 1629514 That child who was popular in the first half of 2020 became a little adult and a limited resurrection discount until January 10

  • amateur uncensoredfc2
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-15
    118 min

    [XRW-963]Targeted Anal 02

  • censoredanalXRWreal workstomimasu diranreal real worksXRW-963XRW963172xrw00963
    • 2021-01-21
    93 min

    [OKS-104]Tight, Soaking Wet, Clinging To Every Curve - Have Your Fill Of Cute Sluts In School Swimsuits! Hidden Camera Voyeur Footage In The Change Room Of Shaved Pussy, Hairy Pussy, Big Tits, Small Tits, Armpit Stubble, And More - Close-Up Fetish An

  • horikita wan censoredbeautiful girlsingle workOKSdaddy s private photosgoddess in a school swimsuitOKS-104OKS1041oks00104
    • 2021-01-23
    116 min

    [NNPJ-431](Aphrodisiac x Sex Chems x Amateur Girls 02) Picking Up An Arty Girl Who Happens To Be Naughty - We Slipped Her An Aphrodisiac Which Brought Her Guard Right Down! She Transformed Into A Total Slut Desperate For Dick Who Came Hard For A Crea

  • censoredcreampiebeautiful girlNNPJnanpa japanNNPJ-431NNPJ431nnpj00431
    • 2021-01-29
    44 min

    [fan-096]あや

  • amateur censoredbig titsamateurfanfan-096fan096fan-096
    • 2021-01-30
    34 min

    FC2PPV 1664992 [Junior-kun ②] When I applied a junior from a sexual desire monster company and a baby-faced beautiful girl … It was more like copulation than naughty (laughs)

  • amateur uncensoredfc2
    • 2021-03-03
    92 min

    FC2PPV 1709725 [Personal shooting / set sale] Two other sticks that the husband eats while taking his daughter to the hospital Complete version

  • amateur uncensoredfc2
    • 2021-03-09
    482 min

    [MUCH-123]Colossal Tits! Big And Bouncy Maniacs 2 Sex With 10 Sluts 8 Hours 2 Video Set

  • megumi arina akatsuki minami censoredcreampiebig titsMUCHmothermuchi mutchiMUCH-123MUCH123h-796much00123
    • 2021-03-12
    58 min

    FC2PPV 1723707 [First individual shooting] Kanae, a vocational school student, 19 years old. !! [Special Edition]

  • amateur uncensoredfc2
    • 2021-03-21
    120 min

    [JUL-517]Middle-Aged Guy And MILF Meet Again On Vacation For Slow, Intimate, Passionate Creampie Sex Momoko Isshiki

  • momoko isshiki censoredcreampiebig titsJULmadonnarokusaburo mishimaJUL-517JUL517jul00517
    • 2021-03-25
    240 min

    [SW-764]All In The Family Daydream - Special Edition. Stepson Gets Hard Over His Stepmom's Hot Bod. "We'll Keep This A Secret From Daddy" She Kindly Cradles His Cock, Then Uses It To Slake Her Lust - 15 Horny MILF SPECIAL!

  • censoredmilfSWswitchyocchanswitch switchSW-764SW7641sw00764
    • 2021-04-02
    157 min

    [NKKD-201]Wife Was Tricked By A Devious Housewife And Made To Register In The Area Wife Prostitution Circle Tsubaki Kato

  • kato camellia kaoru natsuki censoredcreampiebig titsNKKDjet eizomanji groupNKKD-201NKKD201nkkd00201
    • 2021-04-17
    175 min

    [CAWD-211]Real Life College Girl With A Bright Smile Nozomi Kitajo 19 Years Old Kawaii* Exclusive Debut

  • nozomi kitajo censoredsquirtingbeautiful girlCAWDkawaiikyoseiCAWD-211CAWD211cawd00211
    • 2021-04-20
    40 min

    H4610 ki210420 Natsumi Ishiguro 20years old

  • amateur uncensoredh4610
    • 2021-04-22
    63 min

    SIRO-4499 [First shot] [Ubu daughter of withdrawal thought] [Erotic voice leaking] A serious girl who applied to change her inexperienced self. If you teach a naive body pleasure, make a cute voice .. AV application on the net → AV experience shootin

  • amateur censoredamateursirosiro-4499siro4499siro-4499
    • 2021-05-21
    52 min

    509JPAK-012 Yuzu

  • amateur censoreduniformschoolgirljpakjpak-012jpak012509jpak-012
    • 2021-05-31
    99 min

    469G-644 Imadoki Girls’ Circle Exchange (Daddy Activity) Circumstances! Seven

  • amateur censoredcreampieuniformgg-644g644469g-644
    • 2021-06-26
    80 min

    383REIW-077 Mari

  • amateur censoredcreampieamateurreiwreiw-077reiw077383reiw-077
    • 2021-07-01
    61 min

    324SRTD-0235 Dirty Mom Who Wants Saffle Sperm Even Though She Has Just Born

  • amateur censoredcreampiebig titssrtdsrtd-0235srtd0235324srtd-0235
    • 2021-07-13
    43 min

    FC2PPV 1888843 [personal Shooting] Tomohame! I Took A Gonzo Like A Friend ☆ Kanade 32 Years Old ☆

  • amateur uncensoredfc2
    • 2021-07-23
    121 min

    [XVSR-607]The Married Woman Makes A Cuckold Of Her Husband While He Is On A Business Trip - Going At It Non-Stop For 26 Hours With Her Neighbor - Hibiki Otsuki

  • otsuki sound censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-607XVSR607xvsr00607
    • 2021-07-30
    183 min

    [PRED-327]Adult Video Debut Of A Former Announcer For A Local Broadcast Station. Sakura Yoda.

  • sakura yoda censoredsingle workPREDpremiumusapyonbd elegancePRED-327PRED327pred00327
    • 2021-08-06
    56 min

    H4610 ki210810 Misaki Makino 25years Old

  • amateur uncensoredh4610
    • 2021-08-21
    240 min

    [OKAX-763]What Happened When I Touched The Beautiful Masseuse"s Older Sister... 240 Minutes

  • censoredamateurOKAXk m producedick mandokuokazuOKAX-763OKAX763okax00763
    • 2021-09-10
    155 min

    [SSIS-170]Hot Therapist Who Loves To See Men"s O-Faces (In-Ear Whispering, Nipple Play, Cock Teasing, Ball Massage, Anal Rimjob) Experience All 5 Of Her Best Erotic Techniques For 12 Intense Loads Shion Yumi

  • evening beauty censoredbig titshandjobSSISs1 no 1 stylegoemonSSIS-170SSIS170ssis00170
    • 2021-09-18
    94 min

    428SUKE-088 [Sunburn Gal X Sex Addiction] Lika-Chan ★ Sex Addicted Black Gal Bitch Who Works At A Bikini Pub Releases Libido! Squirting Climax All-You-Can-Eat Sex That A Carnivorous Girl With A Maximum Degree Of Muramura And An Unequaled Actor Seek E

  • lika censoredcreampiebig titssukesuke-088suke088428suke-088
    • 2021-09-27
    129 min

    FC2PPV 2255291 [Tif2019 Appearance A ○ Dollar] ~ Limited Quantity ~

  • amateur uncensoredfc2
    • 2021-10-01
    120 min

    [CAWD-291]Passionate Sex And Creampie With A S********l 20 Years My Junior, Starring Asuka Hanahara

  • hanahara asuka censoredcreampieuniformCAWDkawaiikimura hiroyukiCAWD-291CAWD291cawd00291
    • 2021-10-01
    164 min

    [DVDMS-719]"I"m Married Now." Former Entertainer Mika Kisaragi In Lustful Fuck Covered In Juices

  • mika kisaragi censoredsquirtingsingle workDVDMSdeepsyo sukeDVDMS-719DVDMS719dvdms00719
    • 2021-10-21
    108 min

    485GCB-017 Big Tits! K Cup! !! !! Ena Koume Vs Supporting Role (Mob) Virgin! !! !! [This Date Course: [Lake Kawaguchi] Swan Boat ⇒ Ropeway ⇒ Stroll] Throw The Actress In A Circle! Real Document Gachinko Sex!

  • amateur censoredbig titsamateurgcbgcb-017gcb017485gcb-017
    • 2021-11-01
    68 min

    230OREC-919 Fuwarin (Hino Fuwari)

  • amateur censoredcreampiebig titsorecorec-919orec919230orec-919
    • 2021-11-13
    120 min

    [AUKG-526]The Neighbors" Daylight Adultery, A Lesbian Series, Yuri Sasahara, Natsuki Takeuchi

  • yuri sasahara natsuki takeuchi censoredlesbiandramaAUKGu krentoAUKG-526AUKG526aukg00526
    • 2021-12-04
    140 min

    [PKPD-174]An Easy Job Where All You Have To Do Is Get Creampied - Rino Yuki

  • yuki rino censoredcreampiebig titsPKPDfuck group and fun friends daydreamersPKPD-174PKPD174pkpd00174
    • 2021-12-16
    128 min

    [JURA-045]First Time Shooting A Married Woman, Again. Ayame Ushiozaki

  • ayame shiozaki censoredcreampiemarried womanJURAcenter villagejiro fukagawajurakuJURA-045JURA045h-086jura00045
    • 2021-12-17
    122 min

    [OKSN-341]J-cup Divine Big Boobs! Mom"s Big Tits Are Mine Miso"s Mom Lovingly Fulfills My Desires In This Story Miso Mizuhara

  • suwon miso censoredbig titshandjobOKSNabc mousou zokuo kaasan.comOKSN-341OKSN341oksn00341



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download