koharu suzuki




FC2STARSDASDSSISMVSDMIDESHKDAWDHNDAPODCESDPREDRBDMIDVAUKSNATRIPXBLKONEZABWKSBJ

2020-11-03
66 min

Caribbeancom 110320-001 Take a closer look at me..I’m getting so wet Rin Miura

  • rin miura uncensoredcreampiecaribbeancom
    • 2020-11-12
    99 min

    [AKDL-062]Sharing A Hotel Room With A Cute Female Employee When These Babes Take Off Their Business Suits Out Come Their Pretty Little Titties! Look At That Tight Small Waist! Her Pretty Little Ass! When S******g Together In The Same Room With A Girl

  • yukina shida honoka wakamiya censoredbig titsAKDLaquinorishrikenaknrAKDL-062AKDL0621akdl00062
    • 2020-11-13
    115 min

    [DASD-757]Restarting An Erotic Part-time Job With A Superior I Respect And Admire. Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiebeautiful girlDASDdasrokusaburo mishimaDASD-757DASD757dasd00757
    • 2020-11-19
    37 min

    285ENDX-312 20-year-old female college student with cute double teeth (Nozomi) Squirting screaming many times with SEX (2 times of raw chin cum shot) for the first time in a year

  • amateur censoredcreampiesquirtingendxendx-312endx312285endx-312
    • 2020-11-20
    75 min

    FC2PPV 1577558 Limited price for consecutive holidays [Appearance] [Individual shooting] Prefectural Commercial Department ③ Art Department. Bring it to your home and make a vaginal cum shot twice

  • amateur uncensoredfc2
    • 2020-12-18
    59 min

    FC2PPV 1611460 1000pt OFF until December 24th !! [No / Piece] My lover is Santa Claus !？ My beloved Nana turns into Santa, and the hot spring effect causes a big squirt from her pussy !？ This winter’s best vaginal cum shot! ! * There is a face-u

  • amateur uncensoredfc2
    • 2020-12-18
    235 min

    [SIM-101]"I Love You Teacher!" #To The M*nistry Of *ducation, I'm Sorry! #A J* & Teacher After School Raw Fuck Club

  • censoredcreampiecosplaySIMprestigeshirotomanmanSIM-101SIM101118sim00101
    • 2021-01-17
    110 min

    [NYKD-110]First Time Shots At 60 Something - Tsubasa Fukayuki

  • miyuki tsubasa censoredmature womansingle workNYKDrubymaterukazu umiyamayokihiNYKD-110NYKD110nykd00110
    • 2021-01-21
    124 min

    [FSDSS-159]U-IJIN 01 - Fresh Face: Meisa Kawakita

  • kawakita meisa censoredbeautiful girlsingle workFSDSSfalenoboomer 44faleno starFSDSS-159FSDSS1591fsdss00159
    • 2021-01-24
    50 min

    FC2PPV 1657623 Yuka 21 years old A transcendental beauty who came to consult with a job hunting student! If you take off your suit, G cup big breasts and plump big ass! Creampie with seeds on the finest god-style body!

  • amateur uncensoredfc2
    • 2021-02-09
    73 min

    261ARA-476 [Geki Kawa Bishoujo] 21 years old [Smile is the best] Erina-chan is here! The reason for her application to work at a hot spring inn is “I’m lonely because I haven’t met, so I want to lick my cock w” SEX seems to be abs

  • amateur censoredamateuraraara-476ara476261ara-476
    • 2021-02-17
    49 min

    FC2PPV 1689875 [No] [Limited to 100 pieces 2980 → 1480pt OFF!] ♥♥ ️ Super beautiful! Raw Gonzo to Kita 〇 Keiko girls ♥ ️ Massive vaginal cum shot! !! ♥ ️ * Review benefits / Glans Zubozubo Blow

  • amateur uncensoredfc2
    • 2021-02-21
    233 min

    [REXD-352]Good Luck Has Come! Piledriving Her Into The Ground! "I Guess You Can Smell It, If It's Just A Little..."

  • censoredcreampieamateurREXDredmanji groupREXD-352REXD352rexd00352
    • 2021-02-25
    64 min

    [orec-704]とうか

  • amateur censoredcreampiebig titsorecorec-704orec704orec-704
    • 2021-03-07
    243 min

    [MLSM-040]S-class Beautiful Mature Woman BEST Yui Hatano 4 Hours Slender Madonna With Big Tits

  • yui hatano censoredcreampiebig titsMLSMmellow moonMLSM-040MLSM040mlsm00040
    • 2021-03-19
    59 min

    402MNTJ-047 Salina (23)

  • amateur censoredbig titsamateurmntjmntj-047mntj047402mntj-047
    • 2021-04-14
    125 min

    [ARM-971]Urara Kanon's All-POV Masturbation Support - She'll Turn You On With Her Jungle Bush!

  • hanaoto urara censoredanalsingle workARMaroma planningmania satoshiaromaARM-971ARM971arm00971
    • 2021-04-24
    110 min

    [VENX-030]"Your Tits Are On Me..." Have Sex In The Tub With My Super Hot Big Titty Mother In Law Hana Himesaki

  • himesaki hana censoredcreampiebig titsVENXvenusmajime kitanofakecest winntersVENX-030VENX030venx00030
    • 2021-04-24
    131 min

    [MRSS-111]My Big Booty Wife Protected Me From Thugs, And They Ended Up Taking It Out On Her Body... Ema Asahi

  • chaoyang ema censoredcreampiesingle workMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-111MRSS111mrss00111
    • 2021-04-25
    25 min

    FC2PPV 1786862 Up to 30 [Individual] Thirty married woman. She is reluctant to take the place of two strangers but is raped

  • amateur uncensoredfc2
    • 2021-04-26
    49 min

    492JCHA-028 JK Fresh Erotic Oil Massa Treatment 7

  • amateur censoreduniformschoolgirljchajcha-028jcha028492jcha-028
    • 2021-05-04
    70 min

    200GANA-2487 Seriously Nampa, first shot. 1631 This time at the shooting studio, not at the hotel! H individual photo session with cosplay girls found in Akihabara! Yin and Yang who love 2D also fall into the vagina with a big cock and there is no wa

  • amateur censoredamateurcosplayganagana-2487gana2487200gana-2487
    • 2021-06-12
    122 min

    [NASH-521]Stepfamily - Stepson Has A Stepmom-Complex And Cums In Her Pussy

  • censoredcreampiemature womanNASHnadeshikoNASH-521NASH521nash00521
    • 2021-06-12
    138 min

    [CEMD-019]Beauty With Short Hair! She Looks Slender, But Has A Huge Ass like A Duck! Suzu Monami

  • monami bell censoredmature womansingle workCEMDceleb no tomoCEMD-019CEMD019cemd00019
    • 2021-06-16
    141 min

    [SSIS-103]There's Nothing To Do In This Podunk Town, So I Spend My Days Nailing The Busty Babe Next Door - Sweaty Summer Sex Rara Anzai

  • anzai rara censoredbig titssingle workSSISs1 no 1 stylegoemonSSIS-103SSIS103ssis00103
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-02
    110 min

    [FTHT-017](Guiness Class! She Smiles, No Matter What You Do To Her! Her Screaming Point! A Man's Compliant Psychopath!) Once Her Switch Has Been Flipped, There's No Stopping! She Can't Stop! Slap Her Ass Until Her Skin Flushes! He Spreads

  • censoredcreampieFTHTfalenodavielfalenotubeFTHT-017FTHT0171ftht00017
    • 2021-07-21
    47 min

    [072121-001][VR] Physical intimacy with my hot maid

  • rena uncensoredcreampiehandjobcaribbeancom
    • 2021-08-26
    140 min

    [PXH-034]【フルバージョン】神熱AV女優を1日貸切ひたすら本能の中出し交尾。 ACT.11 最旬AV女優×Hcup軟体グラマラス×生ハメ 香坂紗梨

  • amateur censoredcreampiebig titspxhpxh-034pxh034pxh-034
    • 2021-08-27
    61 min

    [WFR-017]The Beautiful Y********l In Uniform Is A Nipple Degenerate, Natsu Tojo

  • natsu tojo censoredsquirtinguniformWFRwaap entertainmentton katsuwWFR-017WFR0172wfr00017
    • 2021-09-04
    137 min

    [BAHP-087]I Became A Porn Actress -Innocent Type College Girl Cums Hard In Porn Debut- Mayu Omikawa

  • mayu komikawa censoredcreampiesingle workBAHPbarutanyoshida daibutsuhoppinBAHP-087BAHP087bahp00087
    • 2021-09-04
    58 min

    H0930 ki210905 Eri Sagawa 33years old

  • amateur uncensoredh0930
    • 2021-09-07
    61 min

    FC2PPV 2170713 [New Work, Half Price! ] ♀ 161 Female College Student ◯ Yu-Chan 23 Years Old 14th Time Av Actress Dirty Little Do Mjd Cleans From Facial Cumshots With Serious Desire Ma ◯ Ko Blow Non-Contraceptive Hard Sex!

  • amateur uncensoredfc2
    • 2021-09-08
    115 min

    241GAREA-521 Kannya

  • amateur censoredamateurbeautiful girlgareagarea-521garea521241garea-521
    • 2021-09-11
    171 min

    [TPIN-011]The Super Sketchy Exhibitionist Method Of Fashion And A Set Of Big Ass And Tits Specialized For Sex Yuka G-Cup Titties

  • censoredcreampieTPINtsubakihoinTPIN-011TPIN011tpin00011
    • 2021-09-18
    148 min

    [FLAV-280]Slutty Bunny Girl Is A Carnivorous Masochistic Bitch Alice Otsu

  • otsu alice censoredbig titssquirtingFLAVdigital arkdigital ark dejitarua kuFLAV-280FLAV280flav00280
    • 2021-09-23
    124 min

    [GS-404]She"s Pretending To Be A****p, Unguarded, And Luring You In, Because She"s A Sweaty Little Devil, Your Little Stepsister!! One Hot Summer Day, While Our Parents Were Away, I Noticed My Little Stepsister"s Panties Were Dripping Wet

  • censoredsisterGSsosoru garconreddo bo ruGS-404GS4041gs00404
    • 2021-09-24
    101 min

    [FTHT-021](Bushy Young Ladies! They"re Raised Properly, But They Have Filthy Deep Throat Pussies! Blushing Suffocation! The Euphoria You"ll Feel As She Looks Up At You With Her Beautiful Eyes!) She May Look Neat And Clean, But She"s Got A

  • censoredcreampiesquirtingFTHTfaleno tubedavielFTHT-021FTHT021h-1602ftht00021
    • 2021-10-02
    104 min

    [SQTE-386]Sensitive F-cups And Hairless Pubis Rina Takase

  • rina takase censoredbig titsblowjobSQTEs cutes cute s cuteSQTE-386SQTE386sqte00386
    • 2021-10-08
    136 min

    [JUL-736]Day after Day of Creampie Orgies That Will Never End for All Eternity. Honoka Yonekura

  • hoika yonekura censoredcreampiemature womanJULmadonnaunicorn fukudaJUL-736JUL736jul00736
    • 2021-10-09
    112 min

    [CMF-064]A Course on the History of Criminal Penalties in Japan: The Trap of Carrying Out Arrest Techniques. Saya Akagi

  • saya akagi censoredbdsmsingle workCMFcinemagicdirty kudouninfuCMF-064CMF064cmf00064
    • 2021-10-30
    115 min

    [MKON-065]Super Serious Girlfriend That Refuses To Have Sex Goes On A Study Trip And Ends Up Sharing A Hotel With Horny College S*****ts For Wild Sex. Hinako Mori

  • hinako mori censoredcreampieuniformMKONkaguya hime pt mousozokuyumesaki ichiroumikonMKON-065MKON065mkon00065
    • 2021-11-16
    63 min

    [111621-001]The Girl Who Seduce With Her Beautiful Boobs

  • nanaha tomori uncensoredcreampiehandjobcaribbeancom
    • 2021-12-07
    49 min

    326KSS-002 Whip Whip Boyne! !! Sister-Based G Pie Busty Daughter And Raw Vaginal Cum Shot Sex That Accepts The Desire Of A Man With Outstanding Charm And Thick Body! !!

  • amateur censoredcreampiebig titsksskss-002kss002326kss-002
    • 2021-12-09
    154 min

    [HBAD-603]Light Skin, Luxurious Step-daughter With A Soft Mound Hidden By Her Mother Has A Pussy That Gets Guys Horny When It"s Played With. Mio Mashiro

  • mio mashiro censoredblowjobsingle workHBADhibinoumanami jirobabeHBAD-603HBAD6031hbad00603
    • 2021-12-11
    56 min

    C0930 ki211211 Noriko Ichikawa 44years old

  • amateur uncensoredc0930
    • 2021-12-11
    134 min

    [CMV-161]Underground Idol"s Dark Work: Enema Brothel Anal Fuck Live Stage

  • narumi natsuki kotori shima censoredlesbiancosplayCMVcinemagicmarukatsuvixenCMV-161CMV161cmv00161
    • 2021-12-13
    82 min

    481SACZ-100 Reika & Yuka / Yuka

  • amateur censoredmarried womanamateursaczsacz-100sacz100481sacz-100



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download