kana yume




FC2AMBIEBODSANNGODGVHCJODSHKDAUKGSSNIMIAAROYDGMEMWAAANACRFSDSSDASDCHRVATIDBBANAUKG

2020-09-05
75 min

300MIUM-620 [Anime voice metamorphosis researcher] My hobby is dissecting mice! ？ The dream of a super-yin-yang sister is I want to do H that is blamed hard like AV! F Switch on if you just rub the milk! Sprinkle the tide and grab it with a fierce pi

  • amateur censoredbig titssquirtingmiummium-620mium620300mium-620
    • 2020-09-29
    66 min

    [ZOZO-015]The New Female Teacher At An All Boys' School Has Her Body Turned Into A Practical Demonstration - Ms Maron Natsuki Edition

  • censoredbig titsZOZOsadistic villageZOZO-015ZOZO0151zozo00015
    • 2020-10-24
    118 min

    [JUL-353]I Was Made To Come Continuously By My Son's Friend Whom I Couldn't Resist... Maki Tomoda

  • maki tomoda censoredbig titsmature womanJULmadonnaamazing meatJUL-353JUL353jul00353
    • 2020-10-30
    65 min

    [OTIM-042][For Distribution Only] [Daydream Impregnation Drama] I Love Dull, Tottering Old Men! Chiharu Miyazawa

  • chiharu miyazawa censoredcreampieuniformOTIMprestigeonetimeOTIM-042OTIM042118otim00042
    • 2020-11-01
    120 min

    [NACR-364]Confinement: I Was Disciplined By My Brainwashed Brother-in-law - Rino Hazuki

  • rino hazuki censoredcreampiebig titsNACRplanet plusbito sakurananakuruNACR-364NACR364h-237nacr00364
    • 2020-11-02
    62 min

    328HMDN-308 [Personal shooting] H cup JD Junna-chan 18 years old Shrimp warp convulsions when raw SEX with cheerleader costume! SEX “Baby Chodai ♪” that has been so comfortable and begged for vaginal cum shot [Sales approved]

  • amateur censoredcreampiebig titshmdnhmdn-308hmdn308328hmdn-308
    • 2020-11-06
    54 min

    417SRCN-048 Whip Butt Flasher J ● Discovered! !! Sneaking up on J ● who enjoys a fiercely dangerous propensity after school and getting a vaginal cum shot in Ma ● Ko who leaks Dada with shame excitement!

  • amateur censoredcreampieschoolgirlsrcnsrcn-048srcn048417srcn-048
    • 2020-11-13
    240 min

    [SOUD-014]Fucking The 20 Hottest Girls At An Illicit Brothel! They'll Even Let You Film It With The (Secret) POV Option - Their Records Released! vol. 2

  • censoredbeautiful girlSOUDprestigebest fuckingSOUD-014SOUD014118soud00014
    • 2020-11-16
    119 min

    [MMRAB-051]せくしい美少女Teen’s図鑑ギリギリ限界DX

  • emma nakajima kiryu nananoha censoredMMRABspice visualmareMMRAB-051MMRAB051406mmrab00051
    • 2020-11-20
    120 min

    [VNDS-3352]Men's Underwear Sales - A Mature Saleswoman's Pillow Business

  • yukari uno miyazono towako censoredblowjobmature womanVNDSstar paradisenext toilet r eVNDS-3352VNDS3352h-254vnds03352
    • 2020-11-28
    102 min

    390JAC-066 [Kamijiri 98cm GAL x 4 vaginal cum shot] In memory of Maradona, the child of God, Kamijiri GAL will be delivered in a hurry! Bomb butt 98 cm! GAL that is just right for God’s ass! Sprinkle the tide of God and climax! GAL who runs thro

  • cmgal censoredcreampiesquirtingjacjac-066jac066390jac-066
    • 2020-12-05
    146 min

    [SSNI-932]Horny Massage Parlor Hottie Busts My Nut. Shion Yumi

  • evening beauty censoredbig titssingle workSSNIs1 no 1 stylenao masakiSSNI-932SSNI932ssni00932
    • 2020-12-05
    119 min

    [PRED-270]Will You Kiss Me With Plenty Of Tongue？ Kano Kashii

  • kashii hanano censoredblowjobslutPREDpremiumkogoro kindaichielegancePRED-270PRED270pred00270
    • 2020-12-06
    39 min

    489IKUIKU-004 Kanna (20)

  • amateur censoredcreampiesquirtingikuikuikuiku-004ikuiku004489ikuiku-004
    • 2020-12-21
    99 min

    [NSPS-955]An Arrogant Wife's Roughed Up Face - Rina Kikuchi

  • rina kikuchi censoredmature womansingle workNSPSnagae stylenagaeNSPS-955NSPS955nsps00955
    • 2020-12-25
    53 min

    [ETQR-183](Daydream POV) Receptionist Who Wants To Get Ravished AOI Aoi Nakajo

  • nakagusuku censoredcreampieuniformETQRerotic timeETQR-183ETQR183h-1186etqr00183
    • 2020-12-30
    118 min

    [RD-1033]Preying On A MILF Divorcee In Her Fifties On Her Way Home From A Speed Dating Event "It's Been So Long Since I Got Hit On, How Embarrassing..."

  • censoredmarried womanblowjobRDathena videomurayamaathenaRD-1033RD1033149rd01033
    • 2021-01-09
    118 min

    [MEYD-649]If You Can't Make The Rent You're Welcome To Pay It With Your Wife's Body. Kyoko Maki

  • maki kyoko censoredcreampiebig titsMEYDtameike gorohirokoji osakiMEYD-649MEYD649meyd00649
    • 2021-02-05
    115 min

    [PARATHD-3100]The Reason Why This Sixty-Something Widow Secretly Filmed Her Stepdaughter And Her Husband's Nightly Activities Deluxe Edition - When He Found Out The Reason, Her Son-In-Law Decided To Provide His Own Brand Of Comfort -

  • censoredamateurmature womanPARATHDparadise tvPARATHD-3100PARATHD3100parathd03100
    • 2021-02-06
    120 min

    [JUL-471]My Husband Can't Satisfy Me... Married Slut Needs Her Boss's Huge Cock Riho Fujimori

  • riho fujimori censoredbig titsmature womanJULmadonnakitorune kawaguchiJUL-471JUL471jul00471
    • 2021-02-11
    110 min

    [FSDSS-166]My New Wife - Sora Fucks Like A Slut, Sora Amakawa

  • tenkawa sora censoredbig titssingle workFSDSSfalenoyamaguchi memberfaleno starFSDSS-166FSDSS1661fsdss00166
    • 2021-02-19
    112 min

    [NCYF-009]Large Orgies - An Endless Six-Some Fuck! Beautiful Girl Cosplayer Honor S*****t, Age 18 (Bred By Back-To-Back Fucks With Her Photographers) Her Virgin Pussy Pounded By Huge Cocks To Screaming Orgasms! 15 Loads Of Semen Get Her Addicted To S

  • censoredcreampiesquirtingNCYFall japan amateur photographers union daudagawaNCYF-009NCYF009ncyf00009
    • 2021-02-26
    39 min

    FC2PPV 1703109 Infiltrate a secret orgy ㉖ Super milk beyond huge breasts! K cup boobs swaying with Brun Brun ♥ Uncles are also excited and can not stand it and vaginal cum shot one after another ♪ * High quality version & review benefits included

  • amateur uncensoredfc2
    • 2021-03-03
    16 min

    FC2PPV 1710106 Goddess Bitchiri Sachii, who exchanges contacts with her followers and connects in many ways, is coming again!

  • amateur uncensoredfc2
    • 2021-03-07
    54 min

    FC2PPV 1679101 Yuko, an active cosmetologist who has an adult sex appeal ❤️ We are looking for someone who will change into naughty underwear and defeat the sexual desire monster that tempts you together.

  • amateur uncensoredfc2
    • 2021-03-11
    120 min

    [IENF-128]Asuka Momose Ultimate Beautiful Y********l Sex Club

  • momose asuka censoredcreampieIENFi energychrysanthemumienfIENF-128IENF1281ienf00128
    • 2021-03-29
    63 min

    292MY-434 Ami Ogawa 2

  • amateur censoredcreampiebig titsmymy-434my434292my-434
    • 2021-04-09
    120 min

    [MUDR-144]I Still Won't Give In... Beautiful Girl Continues To Resist Until She's G*******ged. Breaking In A Proud Babe With S&M And Confinement - Mitsuki Nagisa

  • scooping censoredcreampiebdsmMUDRmukuMUDR-144MUDR144mudr00144
    • 2021-04-09
    213 min

    [BAZX-284]Thick Sex With A Widow In Mourning Dress vol. 003

  • censoredcreampieBAZXbazookatodoBAZX-284BAZX284bazx00284
    • 2021-04-11
    31 min

    FC2PPV 1764980 Up to 18 1980 [No] A tall beauty toy with good looks. She commits all-you-can-eat female body in a public closed room and vaginal cum shot in the back of her vagina.

  • amateur uncensoredfc2
    • 2021-04-29
    190 min

    [278GNAB-054]敏感な乳首を服の中からこねくり回したら発情が止まらなくなったノーブラ奥さん

  • amateur censoredcreampiemarried womangnabgnab-054gnab054278gnab-054
    • 2021-05-12
    110 min

    459TEN-018 [The strongest erotic ass in history] Assault on the home of Miss F milk cabaret captured in Ebisu! !! Bombshell fuck with a special game underwear for gals! !! Poke the peach butt of the prepuri and poke it! !! Raw vaginal cum shot to the

  • amateur censoredcreampiebig titstenten-018ten018459ten-018
    • 2021-05-14
    152 min

    [ROYD-053]My Boss Was Tired, So I Had To Take Him Home ... And Then I Found Myself 1cm Away From Some Amazing Areolas!？ My Boss' Daughter Was Standing There In Her Roomwear, And I Got A Rock Hard Erection! She Lured Me To Temptation With Some Bra

  • saya matsui censoredcreampieschoolgirlROYDroyalkawajirihhh groupROYD-053ROYD053royd00053
    • 2021-05-26
    83 min

    435MFC-109 [Small Devil-based Libido Monster JD] Slender and Shaved Saffle and Norinori Tipsy SEX ♪ Deriheru Preparation Technique Chi ○ Pogatchigachi ↑↑ The big cock is too comfortable to stop swinging and panting Excellent sensitivity by rolling! !

  • amateur censoredcreampieamateurmfcmfc-109mfc109435mfc-109
    • 2021-06-18
    93 min

    483SGK-029 [Dantotsu Do Nasty] [Frenzy Climax Monster] [Dripping Daddy] [Iki Mad Peeing] Dantotsu Do Nasty Older Sister Invades! The drool is drooling and it’s crazy! !! That figure is exactly … a nasty climax monster! !! !! Convulsions jer

  • amateur censoredbig titssquirtingsgksgk-029sgk029483sgk-029
    • 2021-06-20
    106 min

    [SPZ-1105]After Opening A Personal Home Yoga Salon, I Tried To Show The Beautiful Girls My Erect Cock...

  • censoredsquirtingamateurSPZstar paradisestar paradiesSPZ-1105SPZ1105h-254spz01105
    • 2021-07-06
    62 min

    HEYZO 2557 Orgasms With A Horny Pussy Girl Vol.18 – Asuka Motomiya

  • asuka motomiya uncensoredcreampieheyzo
    • 2021-07-17
    117 min

    [CAWD-244]Tailgater - The End Of A Newly Licensed College Girl At The Hands Of A Dangerous Driver By Creampie Sex Moko Sakura

  • sakura moko censoredcreampiedeepthroatCAWDkawaiiamazing meatCAWD-244CAWD244cawd00244
    • 2021-07-19
    63 min

    10musume 071921_01 Trainee Actor’s Trial – Would the Cute Japanese Girl has Big tits Have Sex with Me？ Yuni Katsuragi

  • amateur uncensored10musume
    • 2021-07-31
    136 min

    [FLAV-277]The Sexy Amateur Women In Masks Have Plump, Colossal Tits And Big Asses, And They Are Sluts Who Gratify Our Sexual Desires

  • censoredamateurFLAVdigital arkdigital ark dejitarua kuFLAV-277FLAV277flav00277
    • 2021-08-05
    92 min

    435MFC-130 [Black Gal With Maximum Erotic Deviation] Black Body Gal With Extraordinary Eroticism And Rich Blowjob Vs Dense Cunnilingus Cum Shot Sex From The Battle! [Shiroto Gonzo ＃ Ranran ＃ 24 Years Old ＃ Freeter Who Can Cum Inside By Default]

  • amateur censoredcreampiebig titsmfcmfc-130mfc130435mfc-130
    • 2021-08-06
    42 min

    H0930 ki210807 Kaho Tokita 25years Old

  • amateur uncensoredh0930
    • 2021-08-13
    123 min

    [FOCS-012]Let"s Do It In A Swimsuit! Fun Sex With A Big Tits Bitch In The Hotel"s Pools Who Lives For Fun. Kaho Imai

  • natsuho imai censoredbig titsbeautiful girlFOCSabc mousou zokufocusFOCS-012FOCS012focs00012
    • 2021-08-19
    53 min

    FCP-036 [Delivery Only] You Can Do It Even If It’S Small! !! Super Feeling Good! Fucking! 3

  • amateur censoredamateurbeautiful girlfcpfcp-036fcp036fcp-036
    • 2021-08-30
    46 min

    FC2PPV 2106128 [No] A Beautiful Woman! A Certain 〇〇 Model F Cup! Unauthorized Vaginal Cum Shot From Guarantee Drinking! [Cowgirl] [Back] [Missionary] [Before Deleting]

  • amateur uncensoredfc2
    • 2021-09-11
    18 min

    FC2PPV 2190519 [Individual] The Heroine-Like Wife Of The Tragedy Who Refuses The Stick Of A Raw Stranger And Screams Is Deceived And Poured Into The Vagina.

  • amateur uncensoredfc2
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-17
    58 min

    Caribbeancom 091721-001 Personal Trainer Seduces Hot Slim Athlete Anri Kizuki

  • anri kizuki uncensoredcreampiecaribbeancom



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download