kaho kashii




FC2CJODIPXDASDFSDSSAPODWAAAVEMAMEYDHDKAMIDEMIDVSPRDMVSDLULUNACRHMNCESDSDABATIDNGOD

2020-12-11
21 min

FC2PPV 1602297 [No amateur individual shooting] A plan to bring in a spear man slut married woman who likes to blame! Secretly having sex with an affair in the shower room of the room where the husband is! A spoiled nympho wife who desperately puts u

  • amateur uncensoredfc2
    • 2020-12-18
    120 min

    [BKD-253]Stepmom/Stepson Sex (The Road To Mt. Chausu) Ryo Fukutomi

  • ryo fukutomi censoredmature womansingle workBKDrubykoji tsujitobijiBKD-253BKD253bkd00253
    • 2020-12-24
    80 min

    200GANA-2238 Seriously Nampa, first shot. 1573 Picking Up A Lonely Kuribocchi Girl In Ikebukuro on Christmas Eve! Beautiful breasts exposed in front of the camera with drunken momentum with champagne! A rich blowjob that looks delicious! At the end,

  • amateur censoredbig titsamateurganagana-2238gana2238200gana-2238
    • 2021-01-08
    115 min

    [PARATHD-3083]Penis Ranking List, As Chosen By Porn Actresses Who Sincerely Love Dick From The Bottom Of Their Hearts: Complete Edition

  • miori hara sana mizuhara censoredlesbianPARATHDparadise tvPARATHD-3083PARATHD3083parathd03083
    • 2021-01-22
    72 min

    FC2PPV 1654786 [Major company model] Leaked ● Hard raw acme SEX at a secret cosplay photo session. A narrow pussy is opened with a thick cock and acme died in a few minutes. Forced seeding as it is (leaked Gonzo data)

  • amateur uncensoredfc2
    • 2021-01-27
    52 min

    230OREC-674 Suzu

  • amateur censoredcreampieamateurorecorec-674orec674orec-674
    • 2021-01-29
    39 min

    FC2PPV 1664540 Until 1st 1980pt → 1580pt [Personal shooting] Slender married woman nurse with thick stranger stick and 3P continuous vaginal cum shot. Let me massage oil and squirt M man.

  • amateur uncensoredfc2
    • 2021-01-30
    41 min

    FC2PPV 1665998 [Individual shooting] Saddle a junior sister and vaginal cum shot! I didn’t know and ran away …

  • amateur uncensoredfc2
    • 2021-01-31
    51 min

    [orex-244]美紀さん

  • amateur censoredamateurorexorex-244orex244orex-244
    • 2021-02-01
    131 min

    [EKDV-654]Spread Wide For Intense Orgasms! Mind-Blowing Climaxes! Squirting! G-Spot Training Sex Rei Kuruki

  • satoshi kuruki censoredsquirtingblowjobEKDVcrystal eizoharuo miyafujie kissEKDV-654EKDV65449ekdv00654
    • 2021-02-12
    61 min

    SIRO-4422 [First shot] [Small peach butt] [Honest girl] Insert the T-back with a nice butt. If you repeat a big cock piston to an active female college student with a personality that is easy to be swept away .. Application amateur, first AV shooting

  • amateur censoredamateursirosiro-4422siro4422siro-4422
    • 2021-02-17
    55 min

    FC2PPV 1690322 ☆ First shot ☆ Complete appearance ☆ Tension and quiet slender small breasts beautiful girl JD is the first Gonzo ♥ Oma ○ I found out that this is lewd enough to get wet so I gave it a lot of vaginal cum shot ♥ [With benefits]

  • amateur uncensoredfc2
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-25
    117 min

    [FSDSS-173]I-Cup Tits Cumshot Support Cosplay Sara Kamiki

  • sara kamiki censoredbig titscosplayFSDSSfalenokaorufaleno starFSDSS-173FSDSS1731fsdss00173
    • 2021-03-01
    96 min

    [HIKR-184]Japanese Girls Don't Stop No Matter How Hard Or How Many Times They Squirt And Come! "Watch Me As I Cum..." Challenger: Alex Who Lives Abroad 30 Years Old

  • censoredcreampiebig titsHIKRhikara delusion grouphollywood saburoHIKR-184HIKR184hikr00184
    • 2021-03-13
    155 min

    [MIAA-406]The Married Woman Next Door In My Apartment Building Is Going Through The Doldrums With Her Husband, So When She Started Luring Me To Temptation, I Was Unable To Resist, And Now I'm Always Committing Creampie Infidelity With Her ... Rih

  • riho fujimori kiyoshi maihara censoredcreampieslutMIAAmoodyzkitorune kawaguchieveryone s porn starMIAA-406MIAA406miaa00406
    • 2021-04-09
    119 min

    [MEYD-669]Cheating At Work - Horny Married Slut Hits On Her Coworkers Hat Her Part-Time Job For Daily Creampie Sex Sakura Misaki

  • cape sakura censoredcreampiesingle workMEYDtameike gororyo inugamiMEYD-669MEYD669meyd00669
    • 2021-04-09
    161 min

    [FFFS-026]Taking MILFs Home To Fuck! Married Sluts Enjoying Strangers' Cocks Caught On Camera! Voyeur Footage 23 - Nympho Wives In Their Forties Crave Cock Milk Edition - Ms Kanako, I-Cup, Age 41, 6' Tall Slut - Ms Sanae, F-Cup, Age 40, Looks

  • censoredmature womanFFFSmature woman private videos emmanuellemanji groupFFFS-026FFFS026fffs00026
    • 2021-04-09
    153 min

    [MIDE-908]Your C***dhood Friend Turns You On By Teasing You With Flashes Of Her Panties! Seduced By The Wet Stains On Her Underwear! Rikka Ono

  • rokka ono censoreduniformblowjobMIDEmoodyzgoemonmoodyz divaMIDE-908MIDE908mide00908
    • 2021-04-18
    132 min

    [AGMX-076]Bouncing Titty No Bra Blowjobs ~ Barely Visible Nipples

  • mahiro ichiki natsu tojo censoredbig titsblowjobAGMXsex agent daydreamersdaibutsu yoshidasex agentAGMX-076AGMX076agmx00076
    • 2021-04-23
    124 min

    [DKD-004]Let's Both Take A Bath At Your Place Sachiko

  • sachiko censoredbig titssingle workDKDdream ticketham the mcDKD-004DKD00424dkd00004
    • 2021-04-28
    67 min

    438PVMB-014 Sara

  • amateur censoredcreampieamateurpvmbpvmb-014pvmb014438pvmb-014
    • 2021-05-21
    71 min

    230OREC-768 Nagi

  • amateur censoredamateurorecorec-768orec768230orec-768
    • 2021-05-28
    136 min

    [MIDE-933]My Big Tits Girlfriend And I Confined Ourselves To A 2-Day, 1-Night Hot Spring Resort Vacation Where All We Did Was Fuck Our Brains Out Fumika Nakayama

  • nakayama fumika censoredbig titssingle workMIDEmoodyzmametaro mamezawamoodyz divaMIDE-933MIDE933mide00933
    • 2021-06-03

    FC2PPV 1851396 [Individual shooting 40] Complete appearance 18-year-old pie bread J 〇 Creampie to Miss Refre

  • amateur uncensoredfc2
    • 2021-06-04
    82 min

    [YMDS-032]Young Lady's Catering Service! Angelic Little Ena (K-Cup)'s Devilish Bouncy Big Tits! Ena Koume

  • ena koume censoredcreampiebeautiful girlYMDSmomotaro video publishingasakusa is jiroyoung peachYMDS-032YMDS032ymds00032
    • 2021-06-19
    40 min

    519MAZOF-003 [Excitement] WEB media management site President ♀ 38 years old An estrus female who panting on a man’s penis at night, even though he is a man with a mission of "women’s success". I’m pleased to be hit in the ass

  • amateur censoredcreampieamateurmazofmazof-003mazof003519mazof-003
    • 2021-06-20
    118 min

    [DBER-116]Cruel, Bizarre Sex Training - Ninjas - Female Ninja's Ass Broken In - Episode 2 - The Thousand Delights Of Paradise Rion Izumi

  • rion izumi censoredanalbdsmDBERbabyentertainmentkikubonred babeDBER-116DBER116dber00116
    • 2021-06-23
    55 min

    FC2PPV 1883083 [Complete amateur 111] Ayana 19 years old, complete appearance G cup super beautiful girl, plain clothes bondage raw insertion

  • amateur uncensoredfc2
    • 2021-06-26
    116 min

    [CHCH-008]Step Grandmother And Step Grandson HH

  • censoredbig titsmature womanCHCHmilk and moms emmanuellemilk and momsCHCH-008CHCH008chch00008
    • 2021-07-13
    71 min

    SDJ-008 Ayumi

  • amateur censoredcreampiebig titssdjsdj-008sdj008sdj-008
    • 2021-07-22
    120 min

    [MIAA-477]Female Detective Sneaks In As A Decoy! Aphrodisiac Oil Bondag With Endless Orgasms Version Sakura Tsuji

  • sakura tsuji censoredcreampiebig titsMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-477MIAA477miaa00477
    • 2021-08-21
    133 min

    [CEMD-050]A Girl Who Loves To Dominate And A Girl Who Loves To Be Dominated! Honoka Tsuji / Hana Shirato - Two Girls Of Completely Different Natures Meet For Lesbian Sex, And Both Their Pussies Begin To Climax!

  • white peach tsujii honoka censoredbig titslesbianCEMDserebu no tomoCEMD-050CEMD050cemd00050
    • 2021-09-05
    241 min

    [SCR-280]Video Collection Of Indiscriminate Rough Sex: 4 Hours

  • censoredcreampieuniformSCRglayzs crimeSCR-280SCR28012scr00280
    • 2021-09-09
    117 min

    [FSDSS-294]Going Crazy After Cumming Too Much...Pumping Piston Fuck Leads To Losing Her Mind While Orgasming Over And Over Meisa Kawakita

  • kawakita meisa censoredsingle workFSDSSfalenoyamaguchi memberfaleno starFSDSS-294FSDSS2941fsdss00294
    • 2021-09-10
    115 min

    [JUL-703]Married Woman Secretary Gets Sweaty With Hot Kissing And Fucking In Boss"s Office That Ends In Creampie. Featuring A Blonde Dream Girl Secretary!! Lily Hart

  • lily heart censoredcreampiemature womanJULmadonnanagaeJUL-703JUL703jul00703
    • 2021-09-15
    118 min

    300MIUM-746 [Second Iki Premature Ejaculation Beauty] Emergency Assault On An Amateur’S House During Masturbation. Sensitivity After Crispy Max.

  • amateur censoredbig titsamateurmiummium-746mium746300mium-746
    • 2021-09-17
    120 min

    [EYAN-175]Chubby Lewd Beautiful Wife With Big Tits Wants To Get Pregnant Again With Nonstop Creampie Sex When Husband Is Away. 36 Hours For Risky Unprotected Sex. 22-Year-Old Kasumi.

  • censoredcreampiebig titsEYANe bodyakai suiseihanazakari no tsumatachiEYAN-175EYAN175eyan00175
    • 2021-09-17
    93 min

    277DCV-190 Is It Okay To Send It Home？ Case.184 [Series Most 4p Orgy Sp] I Want To Die In Sex! I Can’t Live Without Sex! 5 People A Day X 365 Days Spear Rolling Beauty! ⇒Crazy Possession Type Monster With A Strangling Piston ⇒ "I Want A Peni

  • amateur censoredamateurdcvdcv-190dcv190277dcv-190
    • 2021-09-17
    124 min

    [FOCS-024]Revealing The Actual State Of A Certain University! A Mixed Bathing Party In Open-air Bath! Super Erotic Camp Where They Party Hard! Natsuna Sasaki

  • natsuna sasaki censoredblowjobsingle workFOCSabc mousou zokufocusFOCS-024FOCS024focs00024
    • 2021-09-21
    97 min

    261ARA-508 [Bright Personality] [Transcendental Huge Breasts] Meychan Is Here! !! The Reason For Her Application For Cleavage Is "Reduced Work And Reduced Income … If You Put Out Your Boobs, You Will Solve The Problem W" You Can Swing Ar

  • amateur censoredbig titsamateuraraara-508ara508261ara-508
    • 2021-09-25
    39 min

    FC2PPV 2248474 [7 Cum Swallow] Absolute Ace Of The Blowjob World. Have You Ever Seen Such A Beautiful Girl’S Egg Blow And Continuous Cum Swallowing？ Swallow Girls ＃ 1 Mio

  • amateur uncensoredfc2
    • 2021-09-29
    46 min

    481SACZ-063 Yuko 5

  • amateur censoredamateurbdsmsaczsacz-063sacz063481sacz-063
    • 2021-10-02
    151 min

    [KTB-053]Fresh OL Club! I Said "Sexual Harrassment Sucks!" But She"s Actually A Slutty Office Worker With Cum All Over Her Uniform Chiharu Miyazawa

  • chiharu miyazawa censoredschoolgirlsingle workKTBkahanshin tigers mousozokukahanshin tigersKTB-053KTB053ktb00053
    • 2021-10-09
    72 min

    H4610 ki211010 Mia Aoki 22years old

  • amateur uncensoredh4610
    • 2021-10-20
    30 min

    279UTSU-520 Yuri-San

  • amateur censoredmarried womanamateurutsuutsu-520utsu520279utsu-520
    • 2021-11-13
    63 min

    355OPCYN-200 Yu (Yu Shinoda)

  • amateur censoredbig titsamateuropcynopcyn-200opcyn200355opcyn-200
    • 2021-11-18
    215 min

    [ABW-169]顔射の美学 18 美女の顔面に溜まりに溜まった白濁男汁をぶちまけろ！！ 小鳩麦【MGSだけのおまけ映像付き 15分】

  • amateur censoredbig titsamateurabwabw-169abw169abw-169



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download