jessica kizaki




FC2AVSAKBISPRDSDABKSBJEBODBBANAMBIABWVEMADASDNATRMILKFSDSSMEYDMVSDWAAAHZGDHDKACESD

2020-10-30
29 min

483HMHI-597 Yayoi

  • amateur censoredbig titsamateurhmhihmhi-597hmhi597hmhi-597
    • 2020-11-12
    124 min

    [FSDSS-124]A Perverted Female Teacher Who Loves D***king Sperm - Special D***king Class Ayaka Tomoda

  • ayaka tomoda censoredblowjobsingle workFSDSSfalenomusetafaleno starFSDSS-124FSDSS1241fsdss00124
    • 2020-11-13
    123 min

    [MDTM-683]Isn't It Fine As Long As She's Bright？ My S*****t Is The Most Erotic Girl In The World. Yukino Nagasawa

  • yukino nagasawa censoredcreampiebig titsMDTMuchu kikakutodoMDTM-683MDTM683h-585mdtm00683
    • 2020-12-01
    241 min

    [EMOIS-014]She's Insecure About Her Height - This Tall Girl Only Had Sex Twice - Mugi Honjo's (20) Porn Debut

  • barley censoredamateursingle workEMOISsod createemotional girlEMOIS-014EMOIS0141emois00014
    • 2020-12-03
    239 min

    [CADV-793]One MILF Slut After Another! Please Introduce Me To All Your Hot Friends! 12 Girls, 4 Hours

  • mika ichijo tokiko kashiwagi censoredcreampiebig titsCADVcrystal picturecrystal exCADV-793CADV79349cadv00793
    • 2020-12-04
    60 min

    328HMDN-317 [Oni cock x married woman] Plump K cup huge breasts married woman 37 years old Personal shooting with a horny wife who makes huge breasts dance with SEX after a long absence. The back is said to be good, so if you put it in the back of th

  • amateur censoredcreampiebig titshmdnhmdn-317hmdn317328hmdn-317
    • 2020-12-04
    48 min

    [lady-358]りん(20)

  • amateur censoredamateurblowjobladylady-358lady358lady-358
    • 2020-12-09
    18 min

    FC2PPV 1599837 [No] Tall G cup busty daughter is continuously vaginal cum shot in the living room

  • amateur uncensoredfc2
    • 2020-12-26
    46 min

    [per-357]くるみ 2

  • amateur censoredamateurblowjobperper-357per357per-357
    • 2021-01-14
    133 min

    [SPRD-1365]Mothers in Law Want To Get Pregnant, Too. Iroha Narumiya

  • narumiya iroha censoredcreampiemature womanSPRDtakara eizohotate ikkanaleddinSPRD-1365SPRD136518sprd01365
    • 2021-01-24
    125 min

    [GENM-071]Vivid POV - She'll Do Anything To Pay Her Bills Suzu Ayano

  • ayano suzuju censoredsingle workGENMgenekig 3GENM-071GENM071genm00071
    • 2021-01-29
    100 min

    FC2PPV 1664475 [No amateur individual shooting] Mental damage reduction Get a simple and naive gamer girl with a game arcade pick-up and bring it in and vaginal cum shot! Although she looked mature, she was a slut who loved to blame and enjoyed the e

  • amateur uncensoredfc2
    • 2021-01-31
    65 min

    SIRO-4351 [First shot] [Idol who is shy] [When blamed for weaknesses ..] The back part-time job started by a super cute underground idol who can not live. Without knowing that the reaction of shame is reflected obscenely .. AV application on the net

  • amateur censoredamateursirosiro-4351siro4351siro-4351
    • 2021-02-03
    46 min

    FC2PPV 1671017 A beautiful woman with fair skin and a secret date at midnight are incompletely burned. Instead, I gave him plenty of squid at the hotel ❤️❤️

  • amateur uncensoredfc2
    • 2021-02-19
    120 min

    [KSBJ-119]A Son's Wife Turned Out To Be A Lewd Woman, Through And Through... Maron Natsuki

  • marin natsuki censoredcreampieblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-119KSBJ119ksbj00119
    • 2021-02-26
    82 min

    230OREC-705 Yuki

  • amateur censoredmarried womanamateurorecorec-705orec705230orec-705
    • 2021-03-06
    62 min

    H4610 ki210306 Gold Pack 20years old

  • amateur uncensoredh4610
    • 2021-03-25
    77 min

    435MFC-092 A Beautiful Big Tits Young Wife Who Has An Affair SEX With A Former Boyfriend Even Though It Is A Wedding Next Week [Gonzo ＃ Hina ＃ 26 Years Old ＃ G Cup (Married Woman)]

  • amateur censoredcreampiebig titsmfcmfc-092mfc092435mfc-092
    • 2021-03-26
    86 min

    510ELLO-003 Pachislot / Karaoke / Private house side Home rental gal god video

  • amateur censoredamateurbeautiful girlelloello-003ello003510ello-003
    • 2021-03-27
    117 min

    [XVSR-584]Sexy Escort Scenes! Dirty Talk Creampie Cowgirl Sex Kotone Suzumiya

  • kotone suzumiya censoredcreampieslutXVSRmax asono kancalenXVSR-584XVSR584xvsr00584
    • 2021-03-29
    49 min

    292MY-425 Goto June

  • amateur censoredbig titsmarried womanmymy-425my425292my-425
    • 2021-03-31
    137 min

    [GVH-211]The Sexy PTA President, The Enchanting Female Teacher, And The Mischievous S*****t Council Rieko Hiraoka / Monami Takarada

  • rieko hiraoka takarada monami censoredmature womanGVHglory questhyonGVH-211GVH21113gvh00211
    • 2021-04-01
    159 min

    [BDSM-074]Suffering Sub - A Record Of Breaking In Akane

  • censoredbdsmBDSMtightbind maniaBDSM-074BDSM074h-1096bdsm00074
    • 2021-04-14
    168 min

    [ROYD-050]Is My Classmate From Back In School Now A Blowjob-Loving Nurse？! She Works The Night Shift - I Bumped Into Her Again At The Hospital And She Salivated For My Cock Miu Narumi

  • narumi miu censoredcreampieblowjobROYDroyalmorikihhh groupROYD-050ROYD050royd00050
    • 2021-04-16
    480 min

    [MTM-005]【期間限定販売】街角シロウトナンパ！ ガールズバー編 酒も入ってノリがいいならどこまでヤレる！？ 15人8時間 SUPER BEST Volume.2

  • amateuramateur censoredamateurmtmmtm-005mtm005mtm-005
    • 2021-04-24
    160 min

    [LULU-066]When Her Big Dick Stepson Had Become Withdrawn And Transformed Into "A C***dish Old Man" This Big Tits Stepmom Ended Up Becoming His Own Personal Glory Hole So That She Could Take Care Of His Sexual Needs Honami Akagi

  • honami akagi censoredcreampiebig titsLULUlunaticsluminaxLULU-066LULU066lulu00066
    • 2021-04-29
    72 min

    200GANA-2479 Seriously Nampa, first shot. 1628 Picking Up Female College Students Who Are Job Hunting Called Interviews! Drink and bring them to the hotel and play with each other … If you notice, break the pantyhose and enjoy the big ass! You c

  • amateur censoredamateurganagana-2479gana2479200gana-2479
    • 2021-05-08
    157 min

    [TPIN-001](Continued) I'm Called The Man Stuck In His C***dhood Room... My Step Mom And Step Sister Will Do Whatever I Want

  • censoredbig titsmomTPINchinpoinTPIN-001TPIN001tpin00001
    • 2021-05-11
    480 min

    [KTRA-298]Continuous Sex With 10 Young Beautiful Girls With Huge Tits 8 Hours 2 Videos

  • sayuri isshiki hinakiku tsubasa censoredcreampiebig titsKTRAk tribeKTRA-298KTRA298h-094ktra00298
    • 2021-05-13
    23 min

    FC2PPV 1816086 * Limited to 200 pieces 980pt [4K HDR] [Blowjob Friend Series] [Standing Nio → Polishing your dick → Ejaculation in the mouth] It usually licks for about 3 hours, but that’s boring, isn’t it？ Short version 2nd [Blow specializ

  • amateur uncensoredfc2
    • 2021-05-31
    79 min

    259LUXU-1421 Luxury TV 1411 A wedding planner with cute sex appeal is now available! If you stroke the transparent silk-like body, it will shake your body and react sensitively, and the joy juice that overflows in proportion to the excitement. Beauti

  • amateur censoredamateurluxuluxu-1421luxu1421259luxu-1421
    • 2021-06-04
    64 min

    518ASGM-005 [Sleep Fucking / Intravaginal Ejaculation] Yokohama Skirt Beautiful Girl Hidden Camera (Kanagawa / Private / Ordinary Course) Estimated D Cup

  • amateur censoredcreampieamateurasgmasgm-005asgm005518asgm-005
    • 2021-06-10
    189 min

    [SW-781]These Girls Spied On Their Mother While She Had Anal Sex!？ When They Saw How Much She Seemed To Enjoy It, They Started To Want To Have A Cock Probe Their Anal Regions As Well!!

  • censoredmomSWswitchcambridgeswitch switchSW-781SW7811sw00781
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-20
    123 min

    [APNS-245]House Call Shame Jun Harumi

  • jun shunmei censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-245APNS245apns00245
    • 2021-06-24
    120 min

    [HBAD-587]A Young Wife Innocently Seduces Men With Her Big Tits And Has Secret Adulterous Sex - Saeko Hiiragi

  • hiiragi saeko censoredbig titsblowjobHBADhibinoumanami jirobabeHBAD-587HBAD5871hbad00587
    • 2021-07-02
    101 min

    [SHKD-956]Escaped Prisoner - Mahiro Ichiki

  • mahiro ichiki censoredsingle workSHKDattackerskinsharkSHKD-956SHKD956shkd00956
    • 2021-07-02
    135 min

    [JUL-638]Innocent And Beautiful Wife Gets Ravished By An Older Corrupt Investigator Who Likes To Use His Authority Mikako Horiuchi

  • mikako horiuchi censoredmature womansingle workJULmadonnaunicorn fukudaJUL-638JUL638jul00638
    • 2021-07-11
    100 min

    390JNT-024 [Service Service ♪] [H Breast Cosplayer] I ● SNS picking up H cup female college students who put erotic selfies on the star! !! The finest H cup that is inevitable for dirt BAN shakes with intense piss! !! A must-see! !! Convulsions cum w

  • amateur censoredcreampiebig titsjntjnt-024jnt024390jnt-024
    • 2021-07-16
    61 min

    FC2PPV 1925457 * Weekend Limited 3980⇒2980pt ★ First Shot ☆ Neat And Clean God Milk Slender Beauty Body Active Jd Asuka-Chan 20 Years Old ☆ Continuous Iki To Blame The Pussy ♥ Iron Man Girl Who Writhes In A Fierce Thrust ♥ Beautiful Breasts Shaking G

  • amateur uncensoredfc2
    • 2021-07-17
    118 min

    [NNPJ-459]Picking Up Girls: Landing A Nordic Amateur And Taking Her Back To A Hotel Room To Fuck... Mind-Blowingly Gorgeous Body And Incredible Sex Skills. "Do You Want Me？ (Wanna Do It？)"

  • censoredblowjobNNPJnanpa japanNNPJ-459NNPJ459nnpj00459
    • 2021-08-06
    120 min

    [IPX-714]My Slut Teacher Messed With My Cherry Boy Cock, And I Could Never Ever Forget The Experience ... Minami Aizawa

  • minami aizawa censoredblowjobslutIPXidea pockettissueIPX-714IPX714ipx00714
    • 2021-08-14
    92 min

    523DHT-0287 It Seems To Be A Neat And Clean Witch, But In Reality It Is An E Cup Big Tits Nympho Wife Mio 49 Years Old

  • amateur censoredcreampiebig titsdhtdht-0287dht0287523dht-0287
    • 2021-08-20
    160 min

    [HMN-038]Snake Woman: By Possessing The Body Of A Human Female, She Licks A Lot, Mates, And Has Sex Yumi Saeki Yumika Saeki.

  • yuka saeki censoredcreampieblowjobHMNhonnakamamezawa mametarouHMN-038HMN038hmn00038
    • 2021-09-03
    119 min

    [HODV-21604]Nasty Older Man Lures A Runaway Girl Back To His Place - Breaking In A Teen Runaway With Confinement Rara Kudo

  • lara kudo censoredcreampiebeautiful girlHODVh m pinugami ryouHODV-21604HODV216045642hodv21604
    • 2021-09-16
    55 min

    10musume 091821_01 I Was Introduced To A G-Cup Busty Girl With A Cute Face Mirai Hayase

  • amateur uncensored10musume
    • 2021-09-18
    148 min

    [USAG-037]Huge J-Cup Colossal Tits Cosplayer From The Country - Self-shot. "There"s Nothing Fun To Do In The Country. I Want To Move To Tokyo, But I"m Too Nervous". Modest Country Girl With Big Tits Spends Entire Day Fucking In Cospla

  • censoredcreampiebig titsUSAGusagi mousozokuUSAG-037USAG037usag00037
    • 2021-09-24
    125 min

    [CLDG-009]The Miracle I-cup Godly Tits Of This C***dcare Worker - Chizuru Shiina

  • chizuru shiina censoredcreampiebig titsCLDGtoyohikotoyohikotoyohiko kikakuCLDG-009CLDG009cldg00009



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download