ichijo




FC2PREDCESDMIAAAVSAHMNSHKDSSNIWANZSQTEGMEMAPODGVHAUKGKSBJADNHNDBLKPPPDLULUJUL

2020-09-19
45 min

230ORETD-739 HAZUKI (Scheduled to graduate from S University, Department of Business Administration)

  • amateur censoredamateurbeautiful girloretdoretd-739oretd739230oretd-739
    • 2020-09-21
    112 min

    [XVSR-556]See Her Unleash Her Full Maternal Instinct From A Boy's Perspective I Want To Snuggle Up To Ms. Mao And Cry Like A Baby! Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsXVSRmax aikuzo yoshidacalenXVSR-556XVSR556xvsr00556
    • 2020-10-03
    120 min

    [PRED-259]My Dear Big Sister-In-Law, It Isn't Infidelity If All You Give Me Is A BLowjob... So Please, Suck Me Off Today, Like You Did The Other Day. Natsuki Takeuchi

  • natsuki takeuchi censoredblowjobsingle workPREDpremiumtrendy yamaguchielegancePRED-259PRED259pred00259
    • 2020-10-09
    151 min

    [SCPX-407]Wife, Is It Okay To Do It？ Your Breasts Touch Against Me So Defenselessly

  • censoredcreampiebig titsSCPXscoopmousouzokuSCPX-407SCPX407h-565scpx00407
    • 2020-10-16
    62 min

    SIRO-4301 [First shot] [Height 150 cm] [Tongue tech exchange] Active sex of former rhythmic gymnastics club girls. The appearance of fighting against a man’s high-level sexual skills is cute and unpleasant .. Application amateur, first AV shooti

  • amateur censoredamateursirosiro-4301siro4301siro-4301
    • 2020-10-20
    63 min

    345SIMM-534 Violet / 25 years old / CA driven by libido

  • amateur censoredcreampiebig titssimmsimm-534simm534345simm-534
    • 2020-10-24
    103 min

    390JAC-063 [Legendary times] [World-class horny beast x 4 vaginal cum shots] The legendary god-time bombing that rewrites the history of Gal Shibecho! !! World-class cum monster! World-class big breasts big butt style! World class vaginal cum shot! W

  • galgalweb censoredcreampiebig titsjacjac-063jac063390jac-063
    • 2020-11-06
    119 min

    [JUL-367]I Was On A Business Trip, And To My Surprise, I Was Booked Into The Same Room With My Lady Boss At Our Business Hotel Momoko Isshiki

  • momoko isshiki censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-367JUL367jul00367
    • 2020-11-06
    240 min

    [SOUD-011]Picking Up Girls For A Halloween Party! 10 Cosplay Cuties From Shibuya Want To Get Wild - And Slutty!!

  • censoredcosplaySOUDprestigebest fuckingSOUD-011SOUD011118soud00011
    • 2020-11-13
    240 min

    [KRU-099]Leaked Hidden Video From an OBGYN of Sexless Wife Can't Take It Anymore and Get's a Medical Examination 18

  • censoredcreampiebig titsKRUkarmamanji groupKRU-099KRU099kru00099
    • 2020-11-18
    43 min

    FC2PPV 1573985 New project ❤️ First shot ❤️ Hidden shot ❤️ Idol face ❤️ Natsu-chan has been vaginal cum shot at a manga cafe ~

  • amateur uncensoredfc2
    • 2020-11-24
    51 min

    [NYH-065]My Friend's Older Sister Tempting Me By Flashing Her Panties In Miniskirt! She Acts Like An Assertive Slut But In Actuality She Loves Being Dominated By The Cock - Yuri Sasahara

  • yuri sasahara censoredslutNYHdirectorsdirectorsnyanjiang houseNYH-065NYH0651nyh00065
    • 2020-11-27
    20 min

    HEYZO 2403 Yu’s Orgasms with Toys – Yu Toyota

  • yu toyota uncensoredblowjobheyzo
    • 2020-11-29
    483 min

    [JUJU-257]This Married Woman Who Works At A Part-Time Job Is Secretly Bringing Her Co-Workers To The Break Room And Turning It Into Her Own Private Fuck Palace Highlights 20 Ladies 8 Hours

  • censoredcreampiemature womanJUJUjukujo japanJUJU-257JUJU257juju00257
    • 2020-12-09
    80 min

    FC2PPV 1599806 [Limited to 3 days] I really did it when I persuaded a black gal dancer & Ibecon woman (^ _-)-☆

  • amateur uncensoredfc2
    • 2020-12-11
    117 min

    [SABA-663]# New Girls In Uniform - Secret Deals For Cash 05 Asuka

  • censoredcreampiebig titsSABAskyu shirototodoSABA-663SABA663h-244saba00663
    • 2020-12-26
    66 min

    [mntj-041]あおい

  • amateur censoredamateurmntjmntj-041mntj041mntj-041
    • 2021-01-07
    78 min

    [REBD-521]Nene: Okinawa Romance Detective - Nene Yoshitaka

  • nine yoshitaka censoredsingle workREBDrebeccacimaREBD-521REBD521h-346rebd00521
    • 2021-01-08
    122 min

    [EQ-540]Handjob Lovers Association Please Play With Your Cock! Women Who Lust For Men Who Masturbate

  • censoredbig titsmature womanEQbullittfetish specialtyEQ-540EQ540h-100eq00540
    • 2021-01-08
    51 min

    230ORETD-827 Nagase-san

  • amateur censoredcreampieuniformoretdoretd-827oretd827oretd-827
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-25
    60 min

    FC2PPV 1659367 ☆ First shot ☆ “I really like naughty ♥” I was told that I shouldn’t put it in the sober and mature JD and raw SEX ♥ who came to Tokyo from the countryside … Oh, maybe it leaked a little w [With benefits] ]

  • amateur uncensoredfc2
    • 2021-02-06
    60 min

    FC2PPV 1675350 55th individual shot, completely original, 2 vaginal cum shots, cute whip whip, pudding pudding, 2 vaginal cum shots

  • amateur uncensoredfc2
    • 2021-02-08
    87 min

    [ant-011]みーちゃん(20)

  • amateur censoredamateurblowjobantant-011ant011ant-011
    • 2021-02-18
    240 min

    [DVDMS-631]Finally Ready For A Facial! One-Way Mirror Cab - Office Girls With Perky Asses Working For Top Corporations In Pants Suits Edition - Squeezing Their Fine Booty Encased In Tight Workwear Makes Their Elite Pussies Wet For Huge Cocks! In Ginz

  • censoredamateurDVDMSdeep sfunky hasegawathe magic mirrorDVDMS-631DVDMS631dvdms00631
    • 2021-03-06
    116 min

    [SSIS-007]When My Husband Was Away For 3 Days, I Kept Getting Roughly Fucked By His Boss. Marin Hinata

  • marin hinata censoredsingle workSSISs1 no 1 styleamazing meatSSIS-007SSIS007ssis00007
    • 2021-03-09
    62 min

    345SIMM-619 A busty wife who is chased by child-rearing exposes a nasty figure that her husband does not even know!

  • amateur censoredcreampiebig titssimmsimm-619simm619345simm-619
    • 2021-03-15
    240 min

    [PYM-368]Self Shots Girls Film Themselves Getting Horny And Masturbating

  • censoredPYMprimoPYM-368PYM368h-283pym00368
    • 2021-03-22
    113 min

    [NSPS-979]She's Keeping A Secret From Her Husband I'm Receiving Breaking In Training From My Big Brother-In-Law Momo Hazuki

  • hazuki peach censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-979NSPS979nsps00979
    • 2021-03-30
    54 min

    292MY-439 Miyuki Nitta

  • amateur censoredcreampiebig titsmymy-439my439292my-439
    • 2021-04-03
    242 min

    [MMB-356]10 Genuinely Degenerate Housewives Who Were Fooled On April Fools Day And Got Creampie Fucked - Please Don't Make A Fool Out Of Me! You Sexy Housewives! -

  • censoredcreampieMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-356MMB356mmb00356
    • 2021-04-17
    55 min

    1Pondo 041721_001 Naughty Kiss and Fucking: Miku Aoyama

  • amateur uncensored1pondo
    • 2021-05-01
    153 min

    [OBA-414]My New Step Son Is A Total Hottie... Nozomi Haneda

  • nozomi haneda censoredmature womanslutOBAmadonnabieber gonzoobasanOBA-414OBA414oba00414
    • 2021-05-01
    153 min

    [JUL-556]Beauty Among Beauties: Fresh Face Megu Mio Makes Her Porn Debut At Age 26! Rated Number 1 Prettiest Married Woman In The Akita, The Prefecture Ranked Number 1 In All Of Japan For Hot Babes

  • mio meg censoredmature womansingle workJULmadonnamametaro mamezawaJUL-556JUL556jul00556
    • 2021-05-14
    115 min

    [SSIS-067]"Ugh, That Bitch Is So Annoying, She Acts Like She's A Celebrity. Pump Her Full Of Your Cum." Betrayed By Her Own Best Friend And Ravished By Low Class Thugs Until She Cums On Camera Mako Iga

  • iga mako blue censoreddeepthroatdramaSSISs1 no 1 stylehirokoji osakiSSIS-067SSIS067ssis00067
    • 2021-05-15
    56 min

    H0930 tk0034 Ayase Tokunaga 35years old

  • amateur uncensoredh0930
    • 2021-05-22
    123 min

    [AVSA-167]Slutty Girl With A Sexy Tongue AIKA

  • aika censoredslutsingle workAVSAavs collector sbuddha davscollector sAVSA-167AVSA167avsa00167
    • 2021-07-06
    113 min

    300NTK-600 Echi Echi Female President! !! Erection is inevitable with beautiful Tekanuru Ero treatment! !! A slender beauty body that is shiny! !! Of course, it’s a natural lotion from Mako, and it’s an erotic lewd constitution! !! Continuo

  • bodynn censoredcreampieamateurntkntk-600ntk600300ntk-600
    • 2021-08-07
    161 min

    [XRLE-014]A Perverted Housewife That Feels Pleasure From Anal Has A Developed Ass-Pussy. Mayu(Alias) 28 Years Old

  • censoredanalcreampieXRLEk m producesugino kireal real worksXRLE-014XRLE014xrle00014
    • 2021-08-20
    120 min

    [HMN-032]"Cum Inside Me For Free" Big Tittied Wife Seeking Young Men"s Sperm To Have A C***d Behind Her Husband"s Back, Starring Ai Sayama

  • sayama love censoredcreampiebig titsHMNhonnakakitorune kawaguchiHMN-032HMN032hmn00032
    • 2021-08-20
    117 min

    [HMN-033]Wife Whose Husband Is Impotent Goes To A Rundown Bachelor Pad To Mate With A Guy Who Has Gone 30 Days Without Ejaculating, Starring JULIA

  • julia censoredcreampiebig titsHMNhonnakahiroaHMN-033HMN033hmn00033
    • 2021-09-24
    240 min

    [CJOB-096]Why Have Sex With A Cold Fish Who Might Be Cute But Has No Passion？ I"ll Fuck Your Brains Out And Give You A Good Time. This Aggressive Slut Will Mount You Without Permission And Pound You To Pieces In This Creampie Best Hits Collection

  • julia aika censoredcreampiebig titsCJOBslut havenslut haven bestCJOB-096CJOB096cjob00096
    • 2021-09-28
    65 min

    324SRTD-0245 A Girl With A Serious Part-Time Job Is Having An Affair … When She Becomes H, She Is Too Different (Yuka Nikaido)

  • amateur censoredcreampiebig titssrtdsrtd-0245srtd0245324srtd-0245
    • 2021-10-02
    241 min

    [MMB-385]Naive Innocent Goes On Mushroom Hunt In Secret From Husband And Mistakes My Thick Tip Cock As One, Then Milks Dry It For Thick Extract

  • hotaru mori marina yuzuki censoredcreampieMMBmomotarou eizou shuppanishikiribashi hakasemomotaro bestMMB-385MMB385mmb00385
    • 2021-10-22
    109 min

    420MGMR-133 AYAKA (25) Amateur Hoi Hoi, Saffle, Pheromone, Libido Monster, Big Breasts, 2 Shots, Oil Fuck, Gal, Lotion, Masturbation, Nasty, Facial Cumshot, Gonzo (Ayaka Mochizuki)

  • amateur censoredbig titsamateurmgmrmgmr-133mgmr133420mgmr-133
    • 2021-10-24
    49 min

    404DHT-0325 Surprisingly Advanced Anal Aunt Her Ageha？ ？？ Age

  • amateur censoredmarried womanamateurdhtdht-0325dht0325404dht-0325
    • 2021-10-28
    131 min

    [JRZE-082]Entering The Biz at 50! Atsuko Yashiro

  • atsuko yashiro censoredcreampiemature womanJRZEcenter villageminatoyashoku ureJRZE-082JRZE082h-086jrze00082
    • 2021-11-19
    477 min

    [OFJE-338]Aka Asuka"s First Best Selections. A First Year Anniversary Since Her Debut with S1. Ten of Her Latest Titles. A Special 8 Hours.

  • arisu aka censoredbig titssingle workOFJEs1 no 1 styleOFJE-338OFJE338ofje00338



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download